ESTScan Details for Unigene SGN-U274214

Score 
57
Direction 
Forward
Predicted Peptide Sequence 
VFSSLIFGRPYTNLRRKLPGHHLSATTAVVYDQHGPPDTVTRVTKIPPVEMNXERGVRENAXQLPSIPPISTE
Predicted Coding Sequence 
GTTTTCTCGTCACTCATATTTGGTCGTCCCTACACAAACCTCCGTCGTAAACTTCCCGGCCACCATCTCTCCGCCACCACCGCCGTTGTC
TACGACCAACACGGCCCTCCCGACACCGTCACAAGGGTTACGAAGATTCCACCGGTGGAGATGAATGAXGAACGAGGTGTGCGTGAAAAT
GCTXTGCAGCTCCCATCAATCCCGCCGATATCAACAGAATAG\
Edits in Original Sequence 
(5')GTTTTCTCGTCACTCATATTTGGTCGTCCCTACACAAACCTCCGTCGTAAACTTCCCGGCCACCATCTCTCCGCCAtCCACCGCCG
TTGTCTACGACCAACACGGCCCTCCCGACACCGTCACAAGGGTTACGAAGATTCCACCGGTGGAGATGAATGAXGAACGAGGTGTGCGTG
AAAATGCTXTGCAGCTCCCATCAATCCCGCCGATATCAACAGAATAG\(3')AGGGTTCCATAAAATTCTCTTTTTCTCCTTTTTATATA
TATATACATATATATATATATATATATCATATAATATCAGTGTTACAAAAAAAATTGAATGAAAAAAAGAATATTTTTCAAAATAATAGT
TGATGTAGTAATTACTAGGTTGTAGGTTTAATTAATTTCAATAAAGAAAAAAAAATACTCTGTGATTTCTTCAAAGGAAAATTACACTAT
ATGAAGTTGGGCATGGTTATATTATTTTTTTTCTAAAGAATAAGGTTTAATGTTATAAATACAACATAAAAAGTGAAAAATGAGTTTTAA
AAAAAACTATTGCTAGTAGAATATGTCAGACATTTCATGAGATTAGTCAAAGTGTGAGCAAATTAAGTCACTATCATATTATAGTCTTGT
TGAATAGGGTTATCTGCTATATATTATTAGTAAAATATGTTAGGCATTTAATGAAATTAGTCAACATGTGAATAAACTAGCTATCCTGAA
TACCATGATTTTATAAATTTCAAGTATTTTTCATTTAGGTTGGGGGGATTCATGAAGTTGTGCTTGGTTATATTTTTCTCTAAAGATATT
CGAATAATCTTCAAGGTTGAGTGTACATAGAAACACATGAAAAGTGAAAATGACTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan