ESTScan Details for Unigene SGN-U274249

Score 
766
Direction 
Forward
Predicted Peptide Sequence 
MEHHTTTSRAEAERLLGVAEKLLREKEFAPCKDFALLAQETEPLLEGPDQILAIAEVLLASVKRINNHHDWYSILQIQGRTEDSELIKKQ
YRRLALLLHPDKNKYPSSDTAFGLVADAWAVLSDPSKKGLYDNELSLFTRVKLTPAGGRGRPRGSYNKQKKGDAKLPVRRSSRASNSGSG
QNQNPNPSPVSQRSYHSVPPKATAPTPMSGAMRGQRVVNLWTACPYCYNLYEYPRVYEGCCLRCDKCKRAFTATEILSMPPMVPGREAYY
CIWGFFPMGFCXMANWRDLGTAKGAAAAAX
Predicted Coding Sequence 
ATGGAACATCATACAACTACAAGCAGAGCAGAAGCAGAGAGACTGTTAGGAGTTGCAGAAAAGCTCTTAAGAGAAAAAGAATTTGCCCCT
TGTAAAGATTTTGCCCTTCTTGCTCAAGAAACTGAGCCTTTACTTGAAGGACCTGACCAGATCTTAGCAATTGCTGAAGTTCTTTTAGCT
TCTGTAAAACGAATCAACAATCACCATGATTGGTACTCTATTCTTCAAATCCAAGGCCGTACTGAAGATTCAGAGCTTATCAAGAAACAG
TATCGTCGTCTTGCTCTTCTTCTTCATCCTGATAAAAACAAATACCCATCTTCAGATACTGCTTTTGGCCTTGTTGCTGATGCCTGGGCT
GTTCTTTCAGATCCATCAAAAAAGGGTCTTTATGATAATGAACTTTCCCTTTTTACTAGAGTTAAATTGACTCCTGCTGGTGGACGAGGA
AGACCTAGAGGGAGTTATAATAAGCAGAAGAAAGGAGATGCTAAGTTACCCGTGAGGAGGAGTAGTCGGGCGAGTAATTCGGGTTCGGGT
CAAAATCAGAACCCGAATCCCAGTCCGGTGAGTCAGAGGAGTTATCATAGCGTGCCGCCGAAGGCTACGGCGCCGACGCCGATGAGTGGT
GCGATGAGAGGGCAAAGGGTTGTGAATTTGTGGACGGCGTGTCCGTATTGTTACAATTTGTATGAGTATCCTAGGGTTTATGAAGGGTGT
TGTTTAAGGTGTGATAAATGTAAAAGGGCTTTTACTGCTACTGAGATTTTGTCAATGCCACCAATGGTGCCAGGGAGAGAAGCTTATTAT
TGCATTTGGGGGTTTTTCCCAATGGGGTTTTGTGAXATGGCGAATTGGAGGGATTTGGGAACTGCGAAAGGAGCTGCTGCTGCTGCTGXX
\
Edits in Original Sequence 
AAAAAGACAATCTTTTTACACTCTACAGTTACACCCCAGTCCCCCCCACCCCCACAAAATTTCTCTTCCTCTTCCCCAAATCATCCATCA
TTTTCTCCGTCTCCAGTTCAGATCAAAACCCCAAAGCCCCAAAATCCCCAAAAATCCACCAAAAA
(5')ATGGAACATCATACAACTACA
AGCAGAGCAGAAGCAGAGAGACTGTTAGGAGTTGCAGAAAAGCTCTTAAGAGAAAAAGAATTTGCCCCTTGTAAAGATTTTGCCCTTCTT
GCTCAAGAAACTGAGCCTTTACTTGAAGGACCTGACCAGATCTTAGCAATTGCTGAAGTTCTTTTAGCTTCTGTAAAACGAATCAACAAT
CACCATGATTGGTACTCTATTCTTCAAATCCAAGGCCGTACTGAAGATTCAGAGCTTATCAAGAAACAGTATCGTCGTCTTGCTCTTCTT
CTTCATCCTGATAAAAACAAATACCCATCTTCAGATACTGCTTTTGGCCTTGTTGCTGATGCCTGGGCTGTTCTTTCAGATCCATCAAAA
AAGGGTCTTTATGATAATGAACTTTCCCTTTTTACTAGAGTTAAATTGACTCCTGCTGGTGGACGAGGAAGACCTAGAGGGAGTTATAAT
AAGCAGAAGAAAGGAGATGCTAAGTTACCCGTGAGGAGGAGTAGTCGGGCGAGTAATTCGGGTTCGGGTCAAAATCAGAACCCGAATCCC
AGTCCGGTGAGTCAGAGGAGTTATCATAGCGTGCCGCCGAAGGCTACGGCGCCGACGCCGATGAGTGGTGCGATGAGAGGGCAAAGGGTT
GTGAATTTGTGGACGGCGTGTCCGTATTGTTACAATTTGTATGAGTATCCTAGGGTTTATGAAGGGTGTTGTTTAAGGTGTGATAAATGT
AAAAGGGCTTTTACTGCTACTGAGATTTTGTCAATGCCACCAATGGTGCCAGGGAGAGAAGCTTATTATTGCATTTGGGGGTTTTTCCCA
ATGGGGTTTTGTGAXATGGCGAATTGGAGGGATTTGGGAACTGCGAAAGGAGCTGCTGCTGCTGCTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan