ESTScan Details for Unigene SGN-U274296

Score 
478
Direction 
Forward
Predicted Peptide Sequence 
PQITLCKKTQIPVKSESMSQLIASHRENAEVYTDPVVCKQKSLELLKEINMPNGLLPLEDIVEVGRNAETGFVWLKQKKAKEHKYKKIGK
LVWYDTEVTAFVENRRMKKLTGVKSKEILIWVTISDISISDPECKKINFATPTGLSRSFPASAFEEEEEEEKKXKLKVSGGILRN
Predicted Coding Sequence 
CCTCAAATCACTCTCTGCAAAAAAACTCAAATCCCTGTGAAATCGGAAAGCATGTCTCAACTTATCGCAAGCCACCGTGAAAATGCCGAA
GTTTACACAGATCCGGTGGTTTGCAAGCAGAAATCACTTGAACTTCTGAAGGAAATCAACATGCCCAATGGTCTTCTCCCACTTGAAGAC
ATCGTGGAAGTCGGCCGCAACGCCGAAACCGGATTCGTGTGGCTGAAACAGAAGAAGGCGAAAGAACACAAGTATAAGAAGATCGGGAAG
CTCGTCTGGTACGATACTGAGGTGACGGCGTTTGTGGAGAATCGCCGGATGAAGAAGCTCACCGGTGTGAAGAGCAAGGAGATCCTCATC
TGGGTTACAATTTCTGATATTTCAATTTCCGATCCGGAGTGTAAGAAGATTAACTTTGCTACCCCTACTGGACTTTCTAGGTCTTTTCCT
GCGTCTGCTTTTGAAGAGGAGGAGGAAGAGGAGAAGAAGXTGAAGTTGAAGGTTTCAGGGGGTATTTTAAGGAATTAA\
Edits in Original Sequence 
(5')CCTCAAATCACTCTCTGCAtAAAAAACTCAAATCCCTGTGAAATCGGAAAGCATGTCTCAACTTATCGCAAGCCACCGTGAAAATG
CCGAAGTTTACACAGATCCGGTGGTTTGCAAGCAGAAATCACTTGAACTTCTGAAGGAAATCAACATGCCCAATGGTCTTCTCCCACTTG
AAGACATCGTGGAAGTCGGCCGCAACGCCGAAACCGGATTCGTGTGGCTGAAACAGAAGAAGGCGAAAGAACACAAGTATAAGAAGATCG
GGAAGCTCGTCTGGTACGATACTGAGGTGACGGCGTTTGTGGAGAATCGCCGGATGAAGAAGCTCACCGGTGTGAAGAGCAAGGAGATCC
TCATCTGGGTTACAATTTCTGATATTTCAATTTCCGATCCGGAGTGTAAGAAGATTAACTTTGCTACCCCTACTGGACTTTCTAGGTCTT
TTCCTGCGTCTGCTTTTGAAGAGGAGGAGGAAGAGGAGAAGAAGXTGAAGTTGAAGGTTTCAGGGGGTATTTTAAGGAATTAA\(3')TA
ATGTGATTTTCATTTTACTAGTACTATTTAAATAATTAAATTACTGTCTTTTTATCTATTTTAATCCTAACCTATGTAACCAAAGTTAAA
AGTGAAAATGGAACTATAGTTTATACTGGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan