ESTScan Details for Unigene SGN-U274307

Score 
402
Direction 
Forward
Predicted Peptide Sequence 
MSETSLRLDAFSSPPRSKRTTNLAHRQCPTGHLGQYRTCHHLRRLNLQVAVIDSFLVDLRQGYTLXGLVEKASPVKEGGGNNDAYSRLLK
SELFGADFGCFSSPAGSKGCANSPMSSPSKNMLRFKTENSGPNSPYSPSVLGHTDTSLSNEVSTPPKPPRKVPKTPHKVLDAPSLQDDFY
LN
Predicted Coding Sequence 
ATGTCCGAAACCTCTCTTCGGCTTGATGCTTTTTCTTCTCCTCCCAGATCAAAGCGAACAACCAATTTGGCTCATCGCCAATGTCCAACA
GGTCACCTCGGACAATATCGAACCTGTCATCATCTCCGTCGTCTAAATCTGCAAGTTGCAGTGATAGATTCATTCCTTGTAGATCTTCGT
CAAGGCTACACACTTXTTGGTCTGGTGGAGAAGGCGTCTCCGGTGAAAGAAGGAGGAGGAAACAATGATGCATATTCCAGGTTGTTGAAA
TCTGAGCTTTTTGGGGCTGATTTTGGTTGTTTCTCTTCTCCTGCAGGTTCTAAAGGATGTGCTAATTCACCCATGAGTAGTCCCAGTAAG
AATATGCTCAGGTTTAAAACTGAAAATTCAGGCCCTAATTCTCCGTATTCCCCTTCGGTTTTGGGGCATACAGATACTTCACTCTCCAAC
GAGGTTTCTACCCCTCCTAAACCCCCTAGGAAAGTGCCCAAAACACCCCACAAGGTTCTGGATGCACCATCACTTCAAGATGACTTCTAT
TTGAAC\
Edits in Original Sequence 
TTCCTTCCTTCTTTCCATCAACAACATAGAGGTTTTTTCTATACAGAATTTGAGCTTCCGCCATTGAATTGAGCTCAAGAAAAAACATGG
AATCGATAACACAAAGAAGAAAGAGTGGAATTAACCTTCCATCTACA
(5')ATGTCCGAAACCTCTCTTCGGCTTGATGCTTTTTCTTCT
CCTCCCAGATCAAAGCGAACAACCAATTTGGCgTCATCGCCAATGTCCAACAGGTCACCTCGGACAATATCGAACCTGTCATCATCTCCG
TCGTCTAAATCTGCAAGTTGCAGTGATAGATTCATTCCTTGTAGATCTTCGTCAAGGCTACACACTTXTTGGTCTGGTGGAGAAGGCGTC
TCCGGTGAAAGAAGGAGGAGGAAACAATGATGCATATTCCAGGTTGTTGAAATCTGAGCTTTTTGGGGCTGATTTTGGTTGTTTCTCTTC
TCCTGCAGGTTCTAAAGGATGTGCTAATTCACCCATGAGTAGTCCCAGTAAGAATATGCTCAGGTTTAAAACTGAAAATTCAGGCCCTAA
TTCTCCGTATTCCCCTTCGGTTTTGGGGCATACAGATACTTCACTCTCCAACGAGGTTTCTACCCCTCCTAAACCCCCTAGGAAAGTGCC
CAAAACACCCCACAAGGTTCTGGATGCACCATCACTTCAAGATGACTTCTATTTGAAC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan