Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U274419

Score 
1024
Direction 
Forward
Predicted Peptide Sequence 
ATGTVSALIGKDYVRTTPKKSCSKLKGLNDETSSNEDVEQFLYSMLGEDSDLSLAVVRDVLCQCGYEVEKALSVLLELSAPSNEQPKLSD
CSANWKEEAVFLHSSDGLTDRTSDSTSHSSEGEVLENVWFWGPPGRNQLKVPAGNSEHSSSSTAGNSGPVLPQDILESLFNMPXPKSAEH
EPTTXELEECSEENDIFGTKKLGSSLYHFEYLSTAAEGAEYQLFRETAKQHWESMRSHYQKAATAFSNGQKGHAAYLADQGRLHNRKAQE
ADAKASQDIFAARNKNIENMITIDLHGQHVKPAMRLLKLHLLFGAFVRSVRLFRVITGCGAHGVGKSKLKNSVVELLKKERIEWTEENRG
TLLIKLDGRMNFSFLDTDDDDDETDHPLGMVASSWAPWILALTVALNVINITILSGVLGGVT
Predicted Coding Sequence 
GCTACTGGAACAGTATCGGCTTTGATAGGGAAAGATTATGTGAGGACAACTCCAAAGAAGAGTTGTTCAAAGCTCAAGGGATTAAATGAC
GAAACATCAAGCAATGAAGATGTTGAGCAGTTTTTGTATTCCATGCTTGGGGAGGACTCTGATTTGAGCTTAGCTGTCGTCAGAGATGTG
TTATGTCAATGCGGATATGAAGTTGAGAAGGCTCTGAGTGTGTTGCTTGAATTATCAGCTCCCTCTAATGAGCAACCTAAGCTTAGCGAC
TGTAGTGCAAACTGGAAAGAAGAGGCTGTGTTTCTTCATTCAAGTGATGGTCTTACTGACAGGACATCTGATTCTACTTCTCATTCATCT
GAAGGCGAAGTTCTAGAAAATGTGTGGTTTTGGGGGCCTCCTGGCAGGAATCAGTTAAAAGTTCCTGCTGGAAACTCTGAACATTCTTCA
TCATCTACAGCAGGAAATTCTGGACCAGTACTTCCTCAAGATATCCTGGAATCTCTGTTTAATATGCCAANCCCCAAGAGTGCTGAACAT
GAACCAACTACTXATGAACTGGAAGAATGTAGTGAAGAAAATGACATTTTTGGGACAAAGAAATTGGGTTCCTCTCTTTACCACTTTGAA
TATCTCTCTACTGCAGCTGAGGGAGCTGAGTATCAGCTGTTCAGGGAAACTGCAAAGCAACATTGGGAGTCAATGAGATCCCATTATCAG
AAGGCTGCAACAGCTTTTTCAAATGGACAAAAGGGACATGCTGCTTATCTTGCGGATCAGGGTAGGCTACACAACAGAAAGGCTCAAGAG
GCTGATGCGAAGGCTAGCCAGGATATATTTGCAGCTAGAAACAAGAACATAGAAAATATGATAACTATCGACTTGCATGGGCAACATGTC
AAACCTGCAATGAGGCTTTTGAAACTGCACCTTCTGTTTGGAGCATTTGTACGCTCTGTTAGGTTGTTCAGAGTTATCACGGGATGTGGG
GCACATGGCGTTGGGAAGTCGAAGCTGAAAAACTCGGTAGTTGAACTTTTGAAGAAAGAACGTATTGAATGGACTGAGGAGAATAGAGGA
ACATTGCTTATCAAGCTCGATGGACGAATGAATTTTAGCTTTCTAGATACTGATGATGATGATGATGAAACTGATCATCCCTTAGGCATG
GTTGCTAGCAGTTGGGCGCCGTGGATTTTAGCATTAACAGTGGCGCTAAATGTAATTAACATCACTATATTATCTGGXGTGCTAGGTGGT
GTAACCTAG\
Edits in Original Sequence 
(5')GCTACTGGAACAGTATCGGCTTTGATAGGGAAAGATTATGTGAGGACAACTCCAAAGAAGAGTTGTTCAAAGCTCAAGGGATTAAA
TGACGAAACATCAAGCAATGAAGATGTTGAGCAGTTTTTGTATTCCATGCTTGGGGAGGACTCTGATTTGAGCTTAGCTGTCGTCAGAGA
TGTGTTATGTCAATGCGGATATGAAGTTGAGAAGGCTCTGAGTGTGTTGCTTGAATTATCAGCTCCCTCTAATGAGCAACCTAAGCTTAG
CGACTGTAGTGCAAACTGGAAAGAAGAGGCTGTGTTTCTTCATTCAAGTGATGGTCTTACTGACAGGACATCTGATTCTACTTCTCATTC
ATCTGAAGGCGAAGTTCTAGAAAATGTGTGGTTTTGGGGGCCTCCTGGCAGGAATCAGTTAAAAGTTCCTGCTGGAAACTCTGAACATTC
TTCATCATCTACAGCAGGAAATTCTGGACCAGTACTTCCTCAAGATATCCTGGAATCTCTGTTTAATATGCCAANCCCCAAGAGTGCTGA
ACATGAACCAACTACTXATGAACTGGAAGAATGTAGTGAAGAAAATGACATTTTTGGGACAAAGAAATTGGGTTCCTCTCTTTACCACTT
TGAATATCTCTCTACTGCAGCTGAGGGAGCTGAGTATCAGCTGTTCAGGGAAACTGCAAAGCAACATTGGGAGTCAATGAGATCCCATTA
TCAGAAGGCTGCAACAGCTTTTTCAAATGGACAAAAGGGACATGCTGCTTATCTTGCGGATCAGGGTAGGCTACACAACAGAAAGGCTCA
AGAGGCTGATGCGAAGGCTAGCCAGGATATATTTGCAGCTAGAAACAAGAACATAGAAAATATGATAACTATCGACTTGCATGGGCAACA
TGTCAAACCTGCAATGAGGCTTTTGAAACTGCACCTTCTGTTTGGAGCATTTGTACGCTCTGTTAGGTTGTTCAGAGTTATCACGGGATG
TGGGGCACATGGCGTTGGGAAGTCGAAGCTGAAAAACTCGGTAGTTGAACTTTTGAAGAAAGAACGTATTGAATGGACTGAGGAGAATAG
AGGAACATTGCTTATCAAGCTCGATGGACGAATGAATTTTAGCTTTCTAGATACTGATGATGATGATGATGAtAACTGATCATCCCTTAG
GCATGGTTGCTAGCAGTTGGGCGCCGTGGATTTTAGCATTAACAGTGGCGCTAAATGTAATTAACATCACTATATTATCTGGXGTGCTAG
GTGGTGTAACCTAG\(3')ATTATGATATTTTACGACATTTACATTTTCTTTTGTTAGTGTGAGAATTGTAAAGGTGTATCCTAGCTCTG
AGTATTATGCAGCATGATAGCTAAGCTCATGTATCAGTGTAGAATGCACATTATGGTAGTAACTGTAATACTCATTTATTCTGGAAAACC
CTTTTTTAGAAAAANNAACTCGAGGGGGGGCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan