ESTScan Details for Unigene SGN-U274481

Score 
647
Direction 
Forward
Predicted Peptide Sequence 
MKKFILNLEVHDVRDKRKALKTVSALPGIDEISMDMKGKKLTIIGTVDPVSVVSKLRKFWPAHIISVGPAKEPEKKEEPKKEEAKKEEGK
KEGEGKKEDAPKEEGKKEEGKKEEGKKDENKKDEPKKDGEKKVEPQPQPMAMPMPMPFPHHQGYNQSVVGMVPPYRPYYPPPHMQAMPYR
PYYPPPAQTYYQVHHSMEENPNSCVIG
Predicted Coding Sequence 
ATGAAGAAATTTATCTTGAATTTGGAGGTGCATGATGTAAGAGACAAGCGCAAGGCCTTGAAAACGGTCTCTGCTCTTCCAGGAATTGAT
GAAATCTCAATGGATATGAAAGGTAAGAAATTAACCATCATCGGAACAGTTGATCCAGTGAGTGTAGTGAGCAAACTACGGAAATTTTGG
CCAGCGCACATAATCTCAGTAGGACCGGCCAAAGAGCCGGAGAAGAAAGAGGAACCAAAGAAAGAAGAGGCCAAGAAAGAGGAGGGTAAG
AAGGAGGGCGAGGGCAAGAAAGAAGACGCTCCAAAGGAGGAAGGTAAGAAAGAGGAGGGTAAGAAGGAAGAAGGTAAGAAGGATGAAAAT
AAGAAAGACGAGCCCAAAAAGGACGGAGAGAAGAAGGTAGAACCACAGCCACAACCAATGGCAATGCCGATGCCGATGCCATTCCCACAT
CATCAAGGCTATAATCAATCTGTGGTTGGCATGGTACCGCCTTATCGGCCATATTATCCTCCTCCTCATATGCAAGCTATGCCCTATCGT
CCATATTATCCTCCTCCCGCGCAAACATACTACCAGGTTCACCACAGCATGGAAGAGAATCCTAATTCATGTGTTATCGGTTAA\
Edits in Original Sequence 
AATAAATTTAACATGTAACCCCTCTCTAAATTAATTTAACTTTTAGCCCCCTCTTCCCCCCCTCCCCTCACCTTTTCCCCGTACAAATTG
CCACTGTTGCCCTCACTGTTATCACCTTTCTTCTCTGTAGCTCCAAATATATAATAACACCATAGCCCATAACCCCTTTTCTGTTTTCTC
TCTCTTATTCTGCATTTTTGTTCTGATTCGGAATTTTTTTCTTTATTTGGGTTCCTTTTCTACCGTCAAATACTCAATTGAACTAATTAG
AAAACCATATATTCGGTTTCTGTCTCTCTACCTCTTCACCATTTCTAGCTTCTTCTCTTTCTCTCTCTACAACTTTTTTTCTTCTGGGTT
TTGATTCTGACTGCAAG
(5')ATGAAGAAATTTATCTTGAATTTGGAGGTGCATGATGTAAGAGACAAGCGCAAGGCCTTGAAAACGGTC
TCTGCTCTTCCAGGAATTGATGAAATCTCAATGGATATGAAAGGTAAGAAATTAACCATCATCGGAACAGTTGATCCAGTGAGTGTAGTG
AGCAAACTACGGAAATTTTGGCCAGCGCACATAATCTCAGTAGGACCGGCCAAAGAGCCGGAGAAGAAAGAGGAACCAAAGAAAGAAGAG
GCCAAGAAAGAGGAGGGTAAGAAGGAGGGCGAGGGCAAGAAAGAAGACGCTCCAAAGGAGGAAGGTAAGAAAGAGGAGGGTAAGAAGGAA
GAAGGTAAGAAGGATGAAAATAAGAAAGACGAGCCCAAAAAGGACGGAGAGAAGAAGGTAGAACCACAGCCACAACCAATGGCAATGCCG
ATGCCGATGCCATTCCCACATCATCAAGGCTATAATCAATCTGTGGTTGGCATGGTACCGCCTTATCGGCCATATTATCCTCCTCCTCAT
ATGCAAGCTATGCCCTATCGTCCATATTATCCTCCTCCCGCGCAAACATACTACCAGGTTCACCACAGCATGGAAGAGAATCCTAATTCA
TGTGTTATCGGTTAA\(3')ATTGGTTCGTTGAGCGGATCAAATCAGATTATATTATCTATACATAGCTCTCCGTTCTTCTTGTTTTGAG
TTGGTCTCGGGTTATATTCTATTAGCATGAACCGAGACTAACATTCAAGAACAGAGAAAATCCATTGTGAATACACAATGATCATGCCAT
CATATTTGTCTTTTCAGAATTAAGAAATTGTGTATAGAGAATTAAATAAGAGTTTTGCTAGCTCCCTTCTTTTGGCTTATAAATTCTTAC
AGAGAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan