ESTScan Details for Unigene SGN-U274513

Score 
635
Direction 
Forward
Predicted Peptide Sequence 
EVAXECIRAAVEKFQNINNTLRSAKSSLRCDSMQGGSNGIGYGLKYQARCIADVKADTDHTSFLTGTLSLKEENEVHLIRISSAGTELLC
EGLFSHPNEIWDLASCPFDQRIFSTVFSSGETYGAAIWQIPELYGQSNSPQLERIASLDAHNSKIKCTLWWPTGRHDKLVSIDEQNLFLW
SFDTSKKNAQVQSQESAGVLHSLTGGAWDPHDYNALALTSESSVQLWDLRTMKKTNSIDHPHVRNLDYNVKREYTLVTAEDESGIHIWDL
RMLKFPVLDLPGHTHWTWTVKCNPEYEDLILSAGTDSAVNLWLASPPSSDEPTSESFX
Predicted Coding Sequence 
XGTGAAGTTGCCGXCGAGTGTATTAGAGCTGCAGTTGAAAAGTTCCAAAATATCAACAACACTTTAAGATCTGCAAAAAGCTCTCTACGC
TGCGATTCAATGCAAGGAGGATCAAATGGAATCGGTTATGGCCTCAAATATCAGGCACGATGCATTGCCGATGTGAAAGCTGATACGGAT
CACACCAGTTTCCTCACCGGAACTCTCAGCCTCAAAGAAGAAAATGAGGTACATTTGATCCGGATTTCTTCAGCTGGTACTGAATTGCTC
TGCGAAGGTCTTTTTTCTCATCCTAATGAGATCTGGGACCTTGCGTCGTGCCCCTTCGATCAACGGATTTTCTCTACTGTTTTTTCTTCC
GGTGAAACATATGGGGCAGCAATATGGCAGATCCCTGAGTTGTATGGCCAGTCGAATTCTCCACAACTAGAGAGGATTGCATCTCTTGAT
GCTCATAATTCGAAGATAAAGTGCACACTTTGGTGGCCAACAGGAAGGCATGACAAGTTGGTTAGCATTGATGAACAGAATCTTTTCCTC
TGGAGCTTTGATACTTCAAAGAAGAATGCACAGGTACAATCACAAGAATCAGCAGGTGTGCTACATTCTTTAACTGGGGGCGCCTGGGAT
CCCCATGATTATAATGCTCTAGCACTAACAAGTGAATCATCAGTCCAACTTTGGGATCTACGGACAATGAAGAAAACAAATTCAATCGAT
CATCCCCATGTCCGTAATTTGGATTATAATGTGAAGAGAGAGTATACACTTGTAACGGCTGAGGATGAATCTGGGATACATATATGGGAT
CTTAGAATGCTGAAGTTTCCAGTCCTTGATCTCCCTGGACATACTCACTGGACATGGACTGTCAAGTGCAATCCCGAATATGAAGACTTA
ATTCTGAGTGCTGGAACTGATTCTGCGGTCAATCTGTGGCTGGCTTCTCCTCCTAGTAGTGACGAACCAACTTCAGAGAGCTTTGAX\
Edits in Original Sequence 
(5')XGTGAAGTTGCCGXCGAGTGTATTAGAGCTGCAGTTGAAAAGTTCCAAAATATCAACAACACTTTAAGATCTGCAAAAAGCTCTCT
ACGCTGCGATTCAATGCAAGGAGGATCAAATGGAATCGGTTATGGCCTCAAATATCAGGCACGATGCATTGCCGATGTGAAAGCTGATAC
GGATCACACCAGTTTCCTCACCGGAACTCTCAGCCTCAAAGAAGAAAATGAGGTACATTTGATCCGGATTTCTTCAGCTGGTACTGAATT
GCTCTGCGAAGGTCTTTTTTCTCATCCTAATGAGATCTGGGACCTTGCGTCGTGCCCCTTCGATCAACGGATTTTCTCTACTGTTTTTTC
TTCCGGTGAAACATATGGGGCAGCAATATGGCAGATCCCTGAGTTGTATGGCCAGTCGAATTCTCCACAACTAGAGAGGATTGCATCTCT
TGATGCTCATAATTCGAAGATAAAGTGCACACTTTGGTGGCCAACAGGAAGGCATGACAAGTTGGTTAGCATTGATGAACAGAATCTTTT
CCTCTGGAGCTTTGATACTTCAAAGAAGAATGCACAGGTACAATCACAAGAATCAGCAGGTGTGCTACATTCTTTAACTGGGGGCGCCTG
GGATCCCCATGATTATAATGCTCTAGCACTAACAAGTGAATCATCAGTCCAACTTTGGGATCTACGGACAATGAAGAAAACAAATTCAAT
CGATCATCCCCATGTCCGTAATTTGGATTATAATGTGAAGAGAGAGTATACACTTGTAACGGCTGAGGATGAATCTGGGATACATATATG
GGATCTTAGAATGCTGAAGTTTCCAGTCCTTGATCTCCCTGGACATACTCACTGGACATGGACTGTCAAGTGCAATCCCGAATATGAAGA
CTTAATTCTGAGTGCTGGAACTGATTCTGCGGTCAATCTGTGGCTGGCTTCTCCTCCTAGTAGTGACGAACCAACTTCAGAGAGCTTTGA
X\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan