Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U274697

Score 
286
Direction 
Forward
Predicted Peptide Sequence 
MARGSSSQSTSSSTTRPGTAAPRGSAAATAGXAPTQAGASSSGGGGGNAVVGSGNASNMLRFYTDDSPGLKVSPTVVLVMSLCFIGFVTT
LHVLGKFYRYRSGSGSGA
Predicted Coding Sequence 
ATGGCGCGAGGCTCTTCTTCTCAATCCACCTCTTCCTCCACAACCCGCCCGGGAACAGCCGCACCCCGTGGCTCTGCCGCCGCTACAGCT
GGTXATGCGCCGACGCAGGCTGGTGCTTCTTCCTCTGGTGGTGGTGGTGGTAACGCTGTAGTAGGCTCCGGCAACGCTAGCAACATGCTC
CGTTTCTATACCGATGATTCTCCAGGTCTGAAAGTTAGCCCGACTGTCGTCCTTGTGATGAGCCTCTGCTTCATCGGATTCGTTACTACT
CTCCATGTCCTCGGCAAATTCTACCGCTACCGATCTGGCTCTGGCTCTGGAGCCTGA\
Edits in Original Sequence 
TCTCCCCATAACCAACA(5')ATGGCGCGAGGCTCTTCTTCTCAATCCACCTCTTCCTCCACAACCCGCCCGGGAACAGCCGCACCCCGT
GGCTCTGCCGCCGCTACAGCTGGTXATGCGCCGACGCAGGCTcGGTGCTTCTTCCTCTGGTGGTGGTGGTGGTAACGCTGTAGTAGGCTC
CGGCAACGCTAGCAACATGCTCCGTTTCTATACCGATGATTCTCCAGGTCTGAAAGTTAGCCCGACTGTCGTCCTTGTGATGAGCCTCTG
CTTCATCGGATTCGTTACTACTCTCCATGTCCTCGGCAAATTCTACCGCTACCGATCTGGCTCTGGCTCTGGAGCCTGA\(3')TTATTC
GGGTTCAGATCTTTGATTTTGAAACACACGTCGTACAGGAAAATTTAGTCTGTTTGTTGTTTTTAATTTCGGTTTTCATTTCACCATCTT
TTGCTGGTTCTGTTTCCGTTTTAGATGGCTGAATTTGACTTTAGGAAGATGATAAAAGAAGCTTCCAATTAAGGGAATTTTGAACGTTTA
CATGTGCTTTTTGTTTTGTCTAATCAGTAACTGCATAGATTTTGTTCAGAACAGGATTATAATTTGGAATTCCGATCCATTTTAGCTATG
TTATTCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan