ESTScan Details for Unigene SGN-U274702

Score 
704
Direction 
Forward
Predicted Peptide Sequence 
MYSDLVEIAPRELKFIFEPKKQSSCTIRLINKSQNHVAFKVKTTSPKKYCVRPNTGIIKPRASCDFTVTMQAQKAPPPDMACKDKFLVQC
TVVAEETVEEDITSAMFSKDDGKYVQENKMRVILVSPPGSPVLSPINVGHSDLPSYIDSPREDQVHGNENICSHQEGDVNGVHNHNGRYQ
ESLTRDQVNPLNQNTPKELDENVKEFRKENADMQMEGKHAQLETRKHDEEMDLVKDVASMKSKIIELERKLSEAKDTISRLTEERKSTAQ
ERESLQRELVMLTSKKGGRKVRVGFPLLYVVTVAFISXGVWLPFALLIEAFNHRCD
Predicted Coding Sequence 
ATGTATTCCGACCTGGTGGAAATTGCACCAAGGGAACTCAAGTTCATATTTGAACCAAAGAAGCAAAGCTCTTGCACTATTCGACTAATT
AATAAGTCCCAAAATCATGTTGCTTTTAAGGTCAAGACTACCAGTCCAAAGAAATATTGTGTTAGGCCAAATACAGGAATTATTAAGCCA
AGAGCATCCTGTGATTTTACAGTGACCATGCAGGCACAAAAGGCACCTCCTCCTGATATGGCGTGCAAGGATAAGTTCTTAGTTCAATGC
ACAGTTGTGGCAGAGGAGACTGTTGAGGAGGATATTACATCAGCCATGTTTTCGAAAGATGATGGCAAATATGTTCAAGAAAATAAGATG
AGAGTGATCCTTGTCAGTCCACCTGGTTCGCCTGTTTTATCACCAATCAATGTAGGACACAGTGATCTTCCAAGTTACATAGATTCACCG
CGAGAAGATCAAGTACATGGTAATGAAAATATCTGTTCACATCAAGAAGGAGATGTCAATGGAGTACATAACCACAATGGAAGATACCAA
GAATCGTTGACCAGAGATCAAGTAAACCCCCTCAATCAAAATACACCGAAGGAACTGGATGAGAATGTAAAGGAGTTTAGAAAGGAAAAT
GCTGACATGCAAATGGAGGGAAAGCATGCACAGTTGGAGACGAGGAAGCATGATGAAGAGATGGACTTAGTCAAGGATGTTGCAAGCATG
AAGTCAAAAATAATTGAACTTGAACGAAAATTAAGTGAGGCCAAAGACACCATCTCAAGGCTAACAGAGGAGAGGAAATCTACCGCTCAA
GAAAGAGAGAGCTTACAAAGAGAACTGGTCATGTTGACAAGTAAGAAAGGCGGAAGAAAAGTGCGGGTTGGATTTCCGCTCCTCTATGTG
GTTACTGTAGCCTTTATTAGTXATGGTGTTTGGTTACCTTTTGCATTACTGATCGAAGCATTTAATCACCGCTGCGACTGA\
Edits in Original Sequence 
GTGAACCCTCTTACGCAATTCACACTGCCCCCTCTACTCTCTCTCTCTCTCTCTCTCTCTCTGTTTCTGATCACCGAACAACCAAAAAAA
TTCCCTCTCTCTCTCCTCTTCATATCCTAGGGTTCATCGATTTATCTATGCATACAATGCACGTTGCTTTCTCTCTCTGTGCATCATTTG
TTTATCTCTAAGAAAGAGAGAGAGAGAGAGGTGACACCATTGATCAGAGGAACGAACAGAGGAGGTCCAAAAGTAACGTTATATTTACGC
TATATTCAATTCCAAGATTGATTCCTCTTTCATTATCATCATTCATTTTCTTCGCCATTGGAAGCTCCGGAAGTGATATCTGTTACTTCG
GATTGAGTTTTAGATAACAAAATAGCC
(5')ATGTATTCCGACCTGGTGGAAATTGCACCAAGGGAACTCAAGTTCATATTTGAACCAAA
GAAGCAAAGCTCTTGCACTATTCGACTAATTAATAAGTCCCAAAATCATGTTGCTTTTAAGGTCAAGACTACCAGTCCAAAGAAATATTG
TGTTAGGCCAAATACAGGAATTATTAAGCCAAGAGCATCCTGTGATTTTACAGTGACCATGCAGGCACAAAAGGCACCTCCTCCTGATAT
GGCGTGCAAGGATAAGTTCTTAGTTCAATGCACAGTTGTGGCAGAGGAGACTGTTGAGGAGGATATTACATCAGCCATGTTTTCGAAAGA
TGATGGCAAATATGTTCAAGAAAATAAGATGAGAGTGATCCTTGTCAGTCCACCTGGTTCGCCTGTTTTATCACCAATCAATGTAGGACA
CAGTGATCTTCCAAGTTACATAGATTCACCGCGAGAAGATCAAGTACATGGTAATGAAAATATCTGTTCACATCAAGAAGGAGATGTCAA
TGGAGTACATAACCACAATGGAAGATACCAAGAATCGTTGACCAGAGATCAAGTAAACCCCCTCAATCAAAATACACCGAAGGAACTGGA
TGAGAATGTAAAGGAGTTTAGAAAGGAAAATGCTGACATGCAAATGGAGGGAAAGCATGCACAGTTGGAGACGAGGAAGCATGATGAAGA
GATGGACTTAGTCAAGGATGTTGCAAGCATGAAGTCAAAAATAATTGAACTTGAACGAAAATTAAGTGAGGCCAAAGACACCATCTCAAG
GCTAACAGAGGAGAGGAAATCTACCGCTCAAGAAAGAGAGAGCTTACAAAGAGAACTGGTCATGTTGACAAGTAAGAAAGGCGGAAGAAA
AGTGCGGGTTGGATTTCCGCTCCTCTATGTGGTTACTGTAGCCTTTATTAGTXATGGTGTTTGGTTACCTTTTGCATTACTGATCGAAGC
ATTTAATaCACCGCTGCGACTGA\(3')AAGGTTATTATGTCTATCTTGATACAGTTTTTCCTTCACAAAGCCCCCATCTGTTCAATCTA
ACGCTGAGGATCAGATATGTTGTTGTATTGACTAGTAGAGTATATCAAGTGTTGTAAATGCTGTTTTTAGATGGAATAAAGTGTAATAAT
CTCCGACTACTACCTAAGCCTGCATCATCGCAGCAGGTAGAGGAGTTGGGTATCTTTTTGCTGGAAGTGTTAATTATATTGATGGTTTTG
TGAGGGTTTTTTTTAACATTTTATGTTCAAAATTTTTGTTGTGCATGTGAACAGTAGTGGCGGGTATGGAGAGCTTTTTGGCGATTACTG
TGAACGCCAAAAGCGTAAAGAGTGTTTCACTTATTTAATCTAGCAAAAGATATTTTAGTTTTCTCAGGAAAGAGCTCTATCAAGGAAATA
TTTTCTTGGTACACATCTCTTTTCCCATTGCAGCTGTTATTCAAGTCTCCTGTCTTGGCTTGAGTTTGCCTTGGGTACCTCTGTTTAATA
TTAGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan