ESTScan Details for Unigene SGN-U274713

Score 
1202
Direction 
Forward
Predicted Peptide Sequence 
MSKNILVTGGAGYIGSHTVLQLLLGGYKTVVVDNLDNSSAIAIKRVQELAGRFGSNLLFYNIDLRDKPAVEKLFESNKFDAVIHFAGLKA
VGESVQKPLMYYNNNITGTITLLEVMATRGCKNLVFSSSSTVYGWPKEVPCTEESPISAANPYGRTKLFAEDICRDVYHSDSQWKVILLR
YFNPIGAHPSGCIGDDPRGIPNNLMPFVQQVAVGRRPALTVYGTDYPTKDGTAVRDYIHVVDLADGHIAALRKLFDPSTGCEVYNLGTGK
GSSVLEVVAAFEKASGKKIPLVMSGRRPGDAEIVYAATEKAERELNWRAKYGIEDIAGISGTGPVKTPTAMKDEGIKVIVQYAPFNCMFF
NGPIIPPVGSTANHQRVDHQSXSFWGKDSAYITRIIEWWNIYIFLTGVLKQWNVFRREEKGIVDE
Predicted Coding Sequence 
ATGTCGAAGAATATATTGGTGACGGGTGGAGCTGGGTATATTGGGAGTCACACGGTGTTACAGTTGCTGTTGGGTGGTTATAAGACAGTG
GTGGTTGATAATTTGGATAATTCATCTGCAATTGCAATCAAAAGGGTTCAGGAACTTGCGGGTCGATTTGGGTCTAACCTTTTGTTTTAC
AATATTGATCTGCGTGATAAGCCTGCAGTTGAAAAGCTTTTCGAGTCTAACAAGTTTGATGCTGTTATACATTTTGCTGGACTAAAAGCA
GTGGGTGAAAGTGTTCAGAAACCTTTGATGTACTATAACAACAATATTACAGGGACAATTACCCTGCTGGAAGTCATGGCAACGCGTGGA
TGCAAAAATCTTGTGTTCTCATCATCATCTACTGTCTATGGTTGGCCAAAAGAGGTTCCTTGTACTGAGGAATCTCCCATAAGTGCTGCA
AATCCTTATGGAAGGACAAAGCTCTTCGCTGAAGATATTTGCCGAGATGTCTACCATTCTGACTCTCAATGGAAAGTCATATTGTTGCGG
TACTTCAATCCTATTGGTGCACATCCAAGTGGCTGTATTGGTGATGATCCACGTGGAATTCCAAACAACCTCATGCCCTTTGTTCAACAA
GTTGCTGTTGGCAGGAGACCAGCACTGACAGTTTATGGAACTGATTATCCAACAAAGGATGGCACTGCGGTACGTGATTACATTCATGTT
GTTGATTTAGCGGATGGCCATATTGCTGCCTTGCGTAAGCTGTTTGATCCTTCGACAGGTTGTGAAGTTTACAACCTGGGAACTGGGAAA
GGATCATCAGTCTTGGAAGTGGTGGCAGCATTTGAGAAGGCATCAGGAAAGAAAATTCCGCTGGTGATGTCTGGTCGAAGACCTGGGGAT
GCTGAAATTGTATACGCAGCAACAGAGAAAGCTGAACGAGAATTGAATTGGAGGGCTAAATATGGCATTGAAGATATTGCCGGGATCAGT
GGAACTGGGCCAGTAAAAACCCCTACGGCTATGAAGGATGAAGGAATCAAAGTGATAGTTCAGTATGCTCCTTTTAACTGCATGTTTTTT
AATGGTCCTATCATTCCACCTGTTGGTTCGACTGCTAATCACCAACGTGTAGACCATCAATCTTXTTCTTTCTGGGGTAAGGATTCCGCG
TATATTACTAGGATCATAGAATGGTGGAATATTTATATTTTTCTAACTGGAGTTCTGAAGCAGTGGAATGTTTTCCGTCGTGAAGAAAAA
GGGATAGTTGATGAATAA\
Edits in Original Sequence 
AAACTTCCTTCCCACATGGCCATTTTTCTCTTCCTTAAAACTATTCTTTGATTTGTATTCTTTACACCCAATGACAGAGAAGAGCTGACA
TCATTCTTTTTCTCACAAATCATCATTATATAAAGTAGACTTTGGACTCTGTTTCAAGTCCGAAAACATCAGATTTTCATTCTCTAACCT
CAAATCGAACCTCTTTTTCTTGAATTTTTGGTTTTTTTTTTATTGTGATTTGGATCA
(5')ATGTCGAAGAATATATTGGTGACGGGTGG
AGCTGGGTATATTGGGAGTCACACGGTGTTACAGTTGCTGTTGGGTGGTTATAAGACAGTGGTGGTTGATAATTTGGATAATTCATCTGC
AATTGCAATCAAAAGGGTTCAGGAACTTGCGGGTCGATTTGGGTCTAACCTTTTGTTTTACAATATTGATCTGCGTGATAAGCCTGCAGT
TGAAAAGCTTTTCGAGTCTAACAAGTTTGATGCTGTTATACATTTTGCTGGACTAAAAGCAGTGGGTGAAAGTGTTCAGAAACCTTTGAT
GTACTATAACAACAATATTACAGGGACAATTACCCTGCTGGAAGTCATGGCAACGCGTGGATGCAAAAATCTTGTGTTCTCATCATCATC
TACTGTCTATGGTTGGCCAAAAGAGGTTCCTTGTACTGAGGAATCTCCCATAAGTGCTGCAAATCCTTATGGAAGGACAAAGCTCTTCGC
TGAAGATATTTGCCGAGATGTCTACCATTCTGACTCTCAATGGAAAGTCATATTGTTGCGGTACTTCAATCCTATTGGTGCACATCCAAG
TGGCTGTATTGGTGATGATCCACGTGGAATTCCAAACAACCTCATGCCCTTTGTTCAACAAGTTGCTGTTGGCAGGAGACCAGCACTGAC
AGTTTATGGAACTGATTATCCAACAAAGGATGGCACTGCGGTACGTGATTACATTCATGTTGTTGATTTAGCGGATGGCCATATTGCTGC
CTTGCGTAAGCTGTTTGATCCTTCGACAGGTTGTGAAGTTTACAACCTGGGAACTGGGAAAGGATCATCAGTCTTGGAAGTGGTGGCAGC
ATTTGAGAAGGCATCAGGAAAGAAAATTCCGCTGGTGATGTCTGGTCGAAGACCTGGGGATGCTGAAATTGTATACGCAGCAACAGAGAA
AGCTGAACGAGAATTGAATTGGAGGGCTAAATATGGCATTGAAGATATgTGCCGGGATCAGTGGAACTGGGCCAGTAAAAACCCCTACGG
CTATGAAGGATcGAAGGAATCAAAGTGATAGTTCAGTATGCTCCTTTTAACTGCATGTTTTTTAATGGTCCTATCATTCCACCTGTTGGT
TCGACTGCTAATCACCAACGTGTAGACCATCAATCTTXTTCTTTCTGGGGTAAGGATTCCGCGTATATTACTAGGATCATAGAATGGTcG
GAATATTTATATTTTTCTAACTGGAGTTCTGAAGCgAGTGGAATGTTTTCCGTCGTGAAGAAAAAGGGATAGTTGATGAATAA\(3')TA
GCTCATTTAGCTGAAACCTATAGTGACATTTTATTCGTTCTTTTATTCTTTGTAACTAGCAGCAGTGCAATCATATTGTTTAAAGATTCT
AATTACATTATTTATGCTTTTGATTATTCTATGTTGGTTCACTGTAAAACCTGTTAAGAAGAAGCAATGTGATGGCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan