ESTScan Details for Unigene SGN-U274755

Score 
202
Direction 
Forward
Predicted Peptide Sequence 
VGHIPKPSLGLNCIGGNAANMVVKFLKQGGTMVTYGGMSKKPITISTSYFIFKDISLKGYLLQEKNLDEAQYRCSIDHLLALVRAGILQY
EMDMVPFKDFHIALEKAMGKQGSQRKQILKF
Predicted Coding Sequence 
GTAGGTCATATACCTAAACCTAGTTTGGGTTTGAATTGTATTGGTGGAAATGCAGCTAATATGGTGGTAAAATTCTTAAAGCAAGGTGGT
ACTATGGTTACATATGGAGGGATGTCAAAGAAGCCAATTACCATATCTACTTCATATTTTATATTCAAGGATATTTCATTAAAAGGATAC
CTGTTACAAGAAAAGAATTTAGATGAAGCACAATATAGGTGTTCGATTGATCATCTATTGGCCCTCGTTCGTGCTGGGATATTGCAATAT
GAGATGGATATGGTACCTTTTAAAGACTTTCATATAGCTCTTGAAAAGGCAATGGGGAAACAAGGAAGTCAAAGGAAACAAATTCTAAAA
TTTTAA\
Edits in Original Sequence 
(5')GTAGGTCATATACCTAAACCTAGTTTGGGTTTGAATTGTATTGGTGGAAATGCAGCTAATATGGTGGTAAAATTCTTAAAGCAAGG
TGGTACTATGGTTACATATGGAGGGATGTCAAAGAAGCCAATTACCATATCTACTTCATATTTTATATTCAAGGATATTTCATTAAAAGG
ATACCTGTTACAAGAAAAGAATTTAGATGAAGCACAATATAGGTGTTCGATTGATCATCTATTGGCCCTCGTTCGTGCTGGGATATTGCA
ATATGAGATGGATATGGTACCTTTTAAAGACTTTCATATAGCTCTTGAAAAGGCAATGGGGAAACAAGGAAGTCAAAGGAAACAAATTCT
AAAATTTTAA\(3')AATATGTTAAGTAATAAATAATTGTAACAATAAGAAAAATATTTTTCCCCTGAGTTTGGGGATATATTTTTCAAG
TTGAATTTCGTAATTTCATTTCTCCCTTCATCATTTGAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan