ESTScan Details for Unigene SGN-U274977

Score 
1010
Direction 
Forward
Predicted Peptide Sequence 
MGDCLVVHTDRLVKANGAEIMDGKNPEMVGSSSAIAVDEKKVLEEEEEEEEGDEEVPLIGRAECRICQEEDSLDKLESPCACSGSLKYTT
EHAFNTGANEKGDITCEICHQQYQPGYTVPPRPVAEETIIDIGGGWQISGTPLNLHDPRVLAIAEAERQLLEAEYDDYNSANASGAAFCR
SAALILMALLLLRHALPMTETDGDDEDPTAFFSLFFFGQLAFFYPATSCSGPSAFCSSAGKXEEAAALAATQFAVVLHSGQPRSVQFTIA
SAAPATPAAPASVDNV
Predicted Coding Sequence 
ATGGGAGATTGTTTGGTAGTGCATACGGATCGTCTTGTGAAGGCTAATGGAGCTGAGATTATGGATGGGAAGAATCCTGAAATGGTGGGG
TCTTCGTCGGCAATAGCTGTAGATGAGAAGAAGGTGCTGGAGGAGGAGGAGGAGGAGGAGGAGGGTGATGAGGAGGTGCCGTTAATTGGT
AGAGCAGAGTGCAGGATTTGCCAGGAGGAGGATTCTTTGGACAAGTTGGAGAGCCCATGTGCTTGCAGTGGAAGCCTCAAGTACACCACC
GAACATGCGTTCAACACTGGTGCXAATGAGAAGGGGGATATTACTTGTGAGATTTGCCATCAGCAATACCAGCCTGGTTACACTGTTCCT
CCTCGACCTGTGGCTGAGGAGACAATTATTGATATTGGGGGAGGATGGCAAATCTCTGGCACTCCTTTGAATTTACATGATCCTCGTGTC
TTGGCAATTGCAGAGGCTGAACGCCAACTTCTGGAAGCTGAATATGATGATTACAATTCTGCTAATGCAAGTGGTGCGGCTTTCTGCCGA
TCCGCTGCTTTAATTTTGATGGCTCTTCTACTCTTGCGCCATGCATTACCAATGACAGAAACAGATGGAGACGATGAAGATCCAACTGCT
TTCTTTTCGCTTTTCTTCTTCGGGCAGTTGGCTTTCTTTTACCCTGCTACATCATGCTCTGGGCCATCAGCATTTTGCAGCAGCGCAGGC
AAAGAXGAGGAAGCTGCAGCATTGGCAGCAACACAATTTGCAGTTGTGTTACACTCTGGACAGCCGAGAAGTGTACAGTTTACCATAGCA
TCAGCTGCACCAGCAACACCAGCAGCGCCTGCTTCAGTGGATAACGTTTAA\
Edits in Original Sequence 
CCAAAAAAGTGCAGAAAACAACAAACAAACCGCGATAATTCAGTGGTTCCTTAGTTCTATTTTGGTATATTTTTCGGACAAATCTAAGAT
AAATACTATAATTAGCAAACACCGTTCAATTTGTTCCGCTACAAATCCGCAGAATTTTTTGGGTTTTTTCTCTTTCCATTTCCTGAATTT
CTTCATTTTCCCAGGAATTGTGTTGTTTTTTTATCTGGGTTTTTAGA
(5')ATGGGAGATTGTTTGGTAGTGCATACGGATCGTCTTGTG
AAGGCTAATGGAGCTGAGATTATGGATGGGAAGAATCCTGAAATGGTGGGGTCTTCGTCGGCAATAGCTGTAGATGAGAAGAAGGTGCTG
GAGGAGGAGGAGGAGGAGGAGGAGGGTGATGAGGAGGTGCCGTTAATTGGTAGAGCAGAGTGCAGGATTTGCCAGGAGGAGGATTCTTTG
GACAAGTTGGAGAGCCCATGTGCTTGCAGTGGAAGCCTCAAGTACACaCACCGAACATGCGTTCAACACTGGTGCXAATGAGAAGGGGGA
TATTACTTGTGAGATTTGCCATCAGCAATACCAGCCTGGTTACACTGTTCCTCCTCGACCTGTGGCTGAGGAGACAATTATTGATATTGG
GGGAGGATGGCAAATCTCTGGCACTCCTTTGAATTTACATGATCCTCGTGTCTTGGCAATTGCAGAGGCTGAACGCCAACTTCTGGAAGC
TGAATATGATGATTACAATTCTGCTAATGCAAGTGGTGCGGCTTTCTGCCGATCCGCTGCTTTAATTTTGATGGCTCTTCTACTCTTGCG
CCATGCATTACCAATGACAGAAACAGATGGAGACGATGAAGATCCAACTGCTTTCTTTTCGCTTTTCTTgCTTCGGGCAGTTGGCTTTCT
TTTACCCTGCTACATCATGCTCTGGGCCATCAGCATTTTGCAGCAGCGCAGGCAAAGAXGAGGAAGCTGCAGCATTGGCAGCAACACAAT
TTGCAGTTGTGTTACACTCTGGACAGCCGAGAAGTGTACAGTTTACCATAGCATCAGCTGCACCAGCAACACCAGCAGCGCCTGCTTCAG
TGGATAACGTTTAA\(3')ACAATAAGACGATCGCGCTTGATCTCTTATTTTGAAGCTAAATCCTGCCTTATGCTTGATTTGTTTATCTG
TATTATGAACAATATCACCATATCTCATCTTTACTAAAAAAATTATGTGTCACTAAGTTGTATATTAATCGTATCATTTAACATCTATGT
ATGACATTTTTGATTAACCTTTCTTGTGCCCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan