ESTScan Details for Unigene SGN-U275045

Score 
593
Direction 
Forward
Predicted Peptide Sequence 
GVPGDRLTSITGPQPLNFNIPIIPTFVNCNXKTHGDSESTIIAEKGEISVPSQYVQPPETRPQIEKTNVKAAVPVIDLSSRTNLLDELKK
ACKEWGAFQVINHKVPISLLDDMRRVGRTFFEGRTMEEKLKYSCDSASPVLKDMAVAMLVASNDTVLDWRDYFDHHTLPSSRRNPSHWPE
SPADYRKVVAEYSDHMKALAQELLGLVSESLDLTCQCIENVVGEFYQNITISYYPPCPQPELTLGLQSHSDFGAITLLIQDDVGGLEVFN
NVEWVSVNPMSNAICVILADQTEIIINGVYKSAQHRAVTNAGRSRLSVATFHDPAKTRQIFPAFHPPRYRPVIYGDYVSSWSTKGPEGKR
TLDALLL
Predicted Coding Sequence 
XXCGGCGTTCCCGGTGACCGTCTCACCTCAATCACCGGTCCTCAACCACTGAATTTCAATATTCCGATCATTCCTACCTTTGTAAATTGT
AACXTAAAAACTCATGGAGACTCTGAGAGTACAATTATTGCTGAAAAAGGTGAGATCTCAGTACCATCACAGTACGTACAACCACCGGAA
ACCAGACCACAAATAGAAAAAACTAACGTAAAAGCAGCTGTACCAGTAATCGATCTCAGTTCACGAACGAACCTTCTCGATGAACTGAAG
AAAGCGTGCAAAGAATGGGGAGCATTTCAAGTGATAAACCATAAGGTTCCGATTAGTTTGTTGGATGATATGAGGCGTGTTGGTCGCACT
TTTTTTGAAGGTCGCACAATGGAAGAGAAGCTTAAGTATTCTTGTGATTCTGCTTCTCCTGTTCTGAAGGATATGGCAGTCGCXATGCTT
GTAGCATCAAATGACACGGTTTTGGATTGGAGAGATTATTTCGATCACCACACTTTGCCTTCATCTCGTCGCAATCCTTCTCATTGGCCC
GAGTCTCCGGCCGATTACAGAAAAGTTGTGGCAGAATACAGCGATCACATGAAAGCTCTCGCACAGGAACTTCTTGGTTTAGTCTCTGAG
AGTCTAGACTTGACATGTCAGTGCATAGAAAATGTTGTTGGGGAGTTTTACCAAAATATCACTATTAGTTACTATCCACCCTGCCCTCAA
CCGGAGCTTACTCTTGGACTGCAATCACATTCTGACTTTGGTGCTATTACACTTCTCATCCAAGATGACGTGGGGGGTCTTGAGGTTTTC
AATAATGTAGAATGGGTTTCTGTAAATCCAATGTCAAATGCTATCTGTGTGATCTTAGCAGACCAAACTGAGATCATAATTAATGGCGTG
TACAAAAGTGCTCAACACCGGGCAGTGACGAATGCTGGAAGATCCAGACTTTCAGTTGCCACATTCCATGACCCTGCCAAGACCAGGCAA
ATTTTTCCAGCCTTCCATCCGCCTAGATATCGTCCAGTGATTTATGGCGACTATGTCTCCTCATGGTCCACTAAAGGGCCAGAAGGGAAG
AGGACCCTTGATGCACTTCTACTTTAA\
Edits in Original Sequence 
(5')XXCGGCGTTCCCGGTGACCGTCTCACCTCAATCACCGGTCCTCAACCACTGAATTTCAATATTCCGATCATTCCTACCTTTGTAAA
TTGTAACXTAAAAACTCATGGAGACTCTGAGAGTACAATTATTgGCTGAAAAAGGTGAGATCTCAGTACCATCACAGTACGTACAACCAC
CGGAAACCAGACCACAAATAGAAAAAACTAACGTAAAAGCAGCTGTACCAGTAATCGATCTCAGTTCACGAACGAACCTTCTCGATGAAC
TGAAGAAAGCGTGCAAAGAATGGGGAGCATTTCAAGTGATAAACCATAAGGTTCCGATTAGTTTGTTGGATGATATGAGGCGTGTTGGTC
GCACTTTTTTTGAAGGTCGCACAATGGAAGAGAAGCTTAAGTATTCTTGTGATTCTGCTTCTCCTGcTTCTGAAGGATATGGCAGTCGCX
ATGCTTGTAGCATCAAATGACACGGTTTTGGATTGGAGAGATTATTTCGATCACCACACTTTGCCTTCATCTCGTCGCAATCCTTCTCAT
TGGCCCGAGTCTCCGGCCGATTACAGAAAAGTTGTGGCAGAATACAGCGATCACATGAAAGCTCTCGCACAGGAACTTCTTGGTTTAGTC
TCTGAGAGTCTAGACTTGACATGTCAGTGCATAGAAAATGTTGTTGGGGAGTTTTACCAAAATATCACTATTAGTTACTATCCACCCTGC
CCTCAACCGGAGCTTACTCTTGGACTGCAATCACATTCTGACTTTGGTGCTATTACACTTCTCATCCAAGATGACGTGGGGGGTCTTGAG
GTTTTCAATAATGTAGAATGGGTTTCTGTAAATCCAATGTCAAATGCTATCTGTGTGATCTTAGCAGACCAAACTGAGATCATAATTAAT
GGCGTGTACAAAAGTGCTCAACACCGGGCAGTGACGAATGCTGGAAGATCCAGACTTTCAGTTGCCACATTCCATGACCCTGCCAAGACC
AGGCAAATTTTTCCAGCCTTCCATCCGCCTAGATATCGTCCAGTGATTTATGGCGACTATGTCTCCTCATGGTCCACTAAAGGGCCAGAA
GGGAAGAGGACCCTTGATGCACTTCTACTTTAA\(3')TTGTTATCTCTCTTTCTGCAGTTACTCATTCAATGTAGAAAAAGTGATCTTT
GTGTTACTTGGGCACAAATTTATGATTCATGCAGATTTTAATGAATAATATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan