ESTScan Details for Unigene SGN-U275153

Score 
255
Direction 
Forward
Predicted Peptide Sequence 
MYFEDWVLIWKLRALEADCSYYVSSWRKHFPYVEESLVVTSKHDVYLMQNYSVMHWSSLLRKVEEVLNVARPLTPTMKYPGSASQTLSRV
QISTMAVRDGLMAAGGFQGELICKYLTNLGVAFATKISNGENAITNAVDISYRSHWAQMRIITGNNDQQXPGFLIAKKLRFAPIX
Predicted Coding Sequence 
ATGTATTTTGAGGACTGGGTTTTGATATGGAAGCTCAGGGCCTTAGAAGCAGATTGCAGTTATTATGTGAGCAGCTGGCGCAAGCATTTT
CCATATGTTGAGGAATCTCTTGTGGTGACATCAAAACATGATGTGTATCTCATGCAAAACTACTCTGTGATGCACTGGTCCTCACTTCTC
AGGAAGGTGGAAGAAGTGCTTAATGTTGCTAGGCCATTGACGCCCACTATGAAATACCCTGGATCAGCGTCTCAAACACTTTCCCGAGTG
CAGATCAGCACTATGGCTGTTAGAGATGGTTTGATGGCTGCTGGGGGTTTCCAAGGGGAGCTTATCTGTAAGTATTTAACCAACCTGGGA
GTTGCATTCGCTACAAAAATAAGTAATGGAGAGAATGCTATCACTAATGCTGTGGATATTAGCTATAGGTCCCACTGGGCTCAAATGAGG
ATAATCACTGGTAATAATGATCAGCAAGXTCCAGGATTTTTGATTGCAAAAAAGCTTCGTTTTGCACCAATCATX\
Edits in Original Sequence 
CAAACGACTCCCATGGCTGCCTCTCTCATTCTTGCCTTTCATGTTGTTTTTTCCTCATTCATTTTTACCTGGGTTTTTTAGTTGTTTGTT
ATTTTACATCATTATAAGTTAGTTAAACAAAAGGATATTTTTTTTGAAACTGGTAATGTATAATAGGATTTGGTTATTCACAGTCTAATC
ATTGTGTGAGCTTTTGGTTGATGATCCCTGTCGCCTTTTTCTTCTTTCCGTGCAATAACTATACTTTTGCAGGTGCTCTGCTCCTAATGT
TCTGGATATTTTGATTTAAACTGTTAGGCTGTTAGTTCACCCTCTCATTAATTCCAGAGGTATGGAGTCTGTATCCTCATCGAAGAATTC
AGTGAGTTTGATGCTTGATATGGAATTTACTTAAACATTGACTATATGTGTCTCTAACGCATTCATGGACAGCTTTCTGGAATAATATGT
CACCAGAGCCAGTATGTTTGAGATGATGCCTCTTATGGCCTCCAAGCTGGTGAATTTGCATCTAATATAAATTTAGCGTTACTTTACCAT
TTCTTAATGCAGCTAATTTATTTTTCTTCTTCTGTTCAGAAAACCAAAAGATTATGCCGAATTTGACTTTTGCCAGTTTCTTTTGTTGCT
TCTAGTAATGGTATTCTGGCTACATGTCGAAGCAAACAAGATTTACATAGGAACCATTCTTTCTTATATTCTGCATTTAGTTTTTAACTC
ATTTTTTTCAGTAAGCAGTTTAGTCTGTGCCTGGATTTTGATGTATTGATCCGAGAGCAGTGTTGACAATATCCTTTTTGTGCAGATTAC
AAACATTTAGAGAAGTGTATGAAACTTTGTAATTGTTGAAGATCCTTGTTTTGGAACTTCACTCTTGAATATTTCATCATGAATCAGCTG
A
(5')ATGTATTTTGAGGACTGGGTTTTGATATGGAAGCTCAGGGCCTTAGAAGCAGATTGCAGTTATTATGTGAGCAGCTGGCGCAAGC
ATTTTCCATATGTTGAGGAATCTCTTGTGGTcGACATCAAAACATGATGTGTATCTCATGCAAAACTACTCTGTGATGCACTGGTCCTCA
CTTCTCAGGAAGGTGGAAGAAGTGCTTAATGTTGCTAGGCCATTGACGCCCACTATGAAATACCCTgGGATCAGCGTCTCAAACACTTTC
CCGAGTGCAGATCAGCACTATGGCTGTTAGAGATGGTTTGATGGCTGCTGGGGGTTTCCAAGGGGAGCTTATCTGTAAGTATTTaAACCA
ACCTGGGAGTTGCATTCGCTACAAAAATAAGTAATGGAGAGAATGCTATCACTAATGCTGTGGATATTAGCTATAGGTCCCACTGGGCTC
AAATGAGGATAATCACTGGtTAATAATGATCAGCAAGXTCCAGGATTTTTGATTGCAAAAAAGCTTCGTTTTGCACCAATCATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan