ESTScan Details for Unigene SGN-U275169

Score 
485
Direction 
Forward
Predicted Peptide Sequence 
MGVEKEVIRAGNGPKPQPGQTVTVHCTGYGKDRDLSQKFWSTKDPGQQPFSFKIGQGKVIKGWDEGVLGMQLGEVARLTCTPDYAYGAGG
FPAWGIQPNSVLVFEIEVLGANEQFANIWAILMELLCTLYSRQLEGIRTVHVLFALMQLVETD
Predicted Coding Sequence 
ATGGGAGTGGAGAAGGAAGTTATCAGAGCCGGTAATGGCCCCAAACCACAGCCTGGTCAAACTGTTACCGTCCACTGCACTGGTTACGGG
AAAGATAGAGACCTGAGTCAGAAGTTCTGGAGCACTAAGGATCCAGGCCAGCAGCCTTTCTCTTTCAAGATCGGCCAAGGCAAAGTTATC
AAAGGATGGGATGAAGGAGTACTGGGCATGCAATTAGGAGAAGTTGCTCGATTAACGTGCACCCCTGATTATGCTTATGGTGCTGGTGGA
TTTCCAGCATGGGGTATTCAGCCAAACTCAGTTCTGGTTTTTGAGATTGAAGTCTTAGGTGCAAATGAGCAATTTGCTAACATTTGGGCA
ATCCTGATGGAGCTGTTGTGTACTCTATACAGTAGACAGCTTGAGGGTATCAGAACTGTTCATGTACTCTTTGCTCTAATGCAACTTGTT
GAAACAGATTAA\
Edits in Original Sequence 
GCTGCAGAATCGGCACGAGGCAAACCCTAAAACAAGAAATCGGAGAATTCATCAAAATCACCGGAAAAA(5')ATGGGAGTGGAGAAGGA
AGTTATCAGAGCCGGTAATGGCCCCAAACCACAGCCTGGTCAAACTGTTACCGTCCACTGCACTGGTTACGGGAAAGATAGAGACCTGAG
TCAGAAGTTCTGGAGCACTAAGGATCCAGGCCAGCAGCCTTTCTCTTTCAAGATCGGCCAAGGCAAAGTTATCAAAGGATGGGATGAAGG
AGTACTGGGCATGCAATTAGGAGAAGTTGCTCGATTAACGTGCACCCCTGATTATGCTTATGGTGCTGGTGGATTTCCAGCATGGGGTAT
TCAGCCAAACTCAGTTCTGGTTTTTGAGATTGAAGTCTTAGGTGCAcAATGAGCAATTTGCTAACATTTGGGCAATCCTGATGGAGCTGT
TGTGTACTCTATACAGTAGACAGCTTGAGGGTATCAGAACTGTTCATGTACTCTTTGCTCTAATGCAACTTGTTGAAACAGATTAA\(3')
GGCGATAATAAATGCTTTCTAGCTTTTCTCTGGATAATGGTCATACTTTGAGACTACTAATTTGCATTACAAGACAAATTAGTTGGTAA
TTAAATATAATATGGAATGGATGTAAGAGTTTGTATGGTCAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan