ESTScan Details for Unigene SGN-U275173

Score 
838
Direction 
Forward
Predicted Peptide Sequence 
MWENLLGQAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSSGDAGGAADRVLNQLLTEMDGM
NAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEDSRHQIFKACLRKSPLSKDIDLRALAKHTQGFSGADITEICQRACKYAIRE
NIEKDIEREKRRQENPDSMDEDVDEVPEIKPAHFEESMKYARRSVSDADIRKYQAFAQTLQQSRGFGTEFRFAEASSGGTAAADPFATSN
AAADDDDHIAEVLVFPCYFTASLLLPGLNSKSKPSTRFWISGFDFLEVKKFKATVYTYLYPGEYFFEFDAQV
Predicted Coding Sequence 
ATGTGGGAAAACCTACTTGGCCAAGCAATTGCAAATGAATGTCAAGCCAATTTTATCAGTGTCAAAGGACCTGAACTGCTCACCATGTGG
TTTGGAGAGAGTGAGGCGAATGTTCGTGAAATTTTCGATAAAGCGAGACAATCTGCACCTTGCGTCCTCTTCTTTGATGAGCTTGACTCT
ATTGCTACTCAGAGGGGAAGCAGCAGTGGAGATGCTGGAGGAGCAGCTGATCGTGTTTTGAACCAACTTCTGACTGAAATGGATGGCATG
AATGCAAAGAAGACTGTTTTTATAATTGGGGCCACCAACAGGCCCGACATAATTGACCCTGCACTTCTTCGACCTGGCCGTCTCGACCAG
TTAATTTATATTCCTCTGCCAGATGAAGATTCACGCCATCAGATTTTCAAGGCATGTCTCAGAAAATCCCCCTTATCAAAGGATATTGAT
CTGAGAGCTCTCGCTAAACATACTCAAGGATTTAGTGGGGCTGATATCACTGAGATTTGTCAACGAGCCTGCAAATATGCCATAAGGGAG
AACATAGAGAAAGATATAGAAAGGGAGAAGAGAAGACAGGAGAATCCCGATTCGATGGATGAGGATGTTGATGAAGTACCAGAGATCAAG
CCTGCTCATTTTGAGGAGTCTATGAAGTATGCACGCCGAAGTGTCAGTGATGCTGATATACGCAAATACCAGGCATTTGCTCAGACATTA
CAGCAGTCTAGAGGTTTTGGAACAGAATTTCGGTTTGCAGAGGCTAGTAGCGGCGGGACTGCTGCAGCTGATCCATTTGCAACTTCTAAT
GCTGCAGCCGATGATGATGACCATATAGCTGAAGTTCTAGTTTTTCCTTGTTATTTTACTGCAAGTCTCCTACTTCCCGGGTTAAACTCG
AAATCGAAACCTAGTACTCGATTCTGGATCTCGGGTTTTGACTTTTTAGAAGTTAAGAAATTTAAAGCTACAGTTTACACTTACTTATAT
CCTGGCGAATATTTTTTTGAATTTGATGCGCAGGTTTAA\
Edits in Original Sequence 
GGCTGCAGAATCGGCACGAGGCTTTTCTATGGTCCCCCAGG(5')ATGTGGGAAAACCTACTTGGCCAAGCAATTGCAAATGAATGTCAA
GCCAATTTTATCAGTGTCAAAGGACCTGAACTGCTCACCATGTGGTTTGGAGAGAGTGAGGCGAATGTTCGTGAAATTTTCGATAAAGCG
AGACAATCTGCACCTTGCGTCCTCTTCTTTGATGAGCTTGACTCTATTGCTACTCAGAGGGGAAGCAGCAGTGGAGATGCTGGAGGAGCA
GCTGATCGTGTTTTGAACCAACTTCTGACTGAAATGGATGGCATGAATGCAAAGAAGACTGTTTTTATAATTGGGGCCACCAACAGGCCC
GACATAATTGACCCTGCACTTCTTCGACCTGGCCGTCTCGACCAGTTAATTTATATTCCTCTGCCAGATGAAGATTCACGCCATCAGATT
TTCAAGGCATGTCTCAGAAAATCCCCCTTATCAAAGGATATTGATCTGAGAGCTCTCGCTAAACATACTCAAGGATTTAGTGGGGCTGAT
ATCACTGAGATTTGTCAACGAGCCTGCAAATATGCCATAAGGGAGAACATAGAGAAAGATATAGAAAGGGAGAAGAGAAGACAGGAGAAT
CCCGATTCGATGGATGAGGATGTTGATGAAGTACCAGAGATCAAGCCTGCTCATTTTGAGGAGTCTATGAAGTATGCACGCCGAAGTGTC
AGTGATGCTGATATACGCAAATACCAGGCATTTGCTCAGACATTACAGCAGTCTAGAGGTTTTGGAACAGAATTTCGGTTTGCAGAGGCT
AGTAGCGGCGGGACTGCTGCAGCTGATCCATTTGCAACTTCTAATGCTGCAGCCGATGATGATGACCtATATAGCTGAAGTTCTAGTTTT
TCCTTGTTATTTTACTGCAAGTCTCCTACTTCCCGGGTTAAACTCGAAtATCGAAACCTAGTACTCGATTCTGGATCTCGGGTTTTGACT
TTTTAGAAcGTTAAGAtAATTTAAAGCTACAGTTTACACTTACTTATATCCTGGCGAATATTTTTTTGAATTTGATGCGCAGGTTTAA\
(3')ATAGCCTAGTTTAAACAAAAAAAGATGAAAAAACTCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan