ESTScan Details for Unigene SGN-U275227

Score 
535
Direction 
Forward
Predicted Peptide Sequence 
KANIARKESAEDTHAPVEEKRLATWGTEVPDDLVLDQQKLAEALKKEDEKRREERDERKRKYNVKYNDEVTPEEMEAYRMKKVLRDDPMR
DFXALSYTEEGSPLLLGWQCTFIGSTCHLHTQENERLSLSSVRLSVL
Predicted Coding Sequence 
XTGAAGGCCAATATTGCTCGCAAGGAGTCTGCTGAAGATACACATGCACCGGTTGAGGAGAAGAGGCTTGCTACTTGGGGAACTGAAGTT
CCTGACGATTTGGTTCTGGACCAGCAAAAGCTGGCTGAAGCTCTTAAAAAGGAAGATGAAAAGAGAAGAGAAGAGAGGGATGAAAGGAAA
AGGAAATACAACGTGAAGTACAATGACGAGGTTACACCGGAAGAAATGGAGGCCTACAGAATGAAAAAGGTCCTCCGTGACGATCCAATG
AGGGACTTTXTTGCACTGAGTTATACAGAAGAGGGAAGTCCTTTGCTGCTTGGGTGGCAGTGCACCTTTATAGGTAGCACTTGCCATTTG
CATACCCAGGAGAATGAAAGGTTAAGTCTGAGTTCTGTCCGTTTGTCAGTTCTTTGA\
Edits in Original Sequence 
(5')XTGAAGGCCAATATTGCTCGCAAGGAGTCTGCTGAAGATACACATGCACCGGTTGAGGAGAAGAGGCTTGCTACTTGGGGAACTGA
AGTTCCTGACGATTTGGTTCTGGACCAGCAAAAGCTGGCTGAAGCTCTTAAAAAGGAAGATGAAAAGAGAAGAGAAGAGAGGGATGAAAG
GAAAAGGAAATACAACGTGAAGTACAATGACGAGGTTACACCGGAAGAAATGGAGGCCTACAGAATGAAAAAGGTCCTCCGTGACGATCC
AATGAGGGACTTTXTTGCACTGAGTTATACAGAAGAGGGAAGTCCTTTGCTGCTTGGGTGGCAGTGCACCTTTATAGGTAGCACTTGCCA
TTTGCATACCCAGGAGAATGAAAGGTTAAGTCTGAGTTCTGTCCGTTTGTCAGTTCTTTGA\(3')TTTGGTTTGCAATGTTATTAGTAA
AATACACACCATGCATTATTAGTTAGTTAGGGTAAATAAAGGACTTACACGTCTTTGGATGATTGACACTCCTCCTGCGCGTTGCTGTCA
AGTGTCCTGATTTATCAATTGTATATACGCACTGGGTTTTGTGAGATCATATTTTTCTCTTTAATAGCTCCAAATTTGACATATCTAGCG
TGAGAACTCTTTAATTCCATCATTTTCATTTTCTTTTTATATCAGGGATTTTATTTATTTATCTACACTGGATAAAGATTTGAATTCAAA
TTTTATTCACCAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan