ESTScan Details for Unigene SGN-U275279

Score 
596
Direction 
Forward
Predicted Peptide Sequence 
RAPLEIAAVGIGGXSTPLFISGEESGDFEAFMFVDTLKKQCNFSICGSFVHDLFVGVGVGLPCTVMECGDIIYRSTLPKSNGITVTVPGV
ILALGTLSYLWATPGVAPGFFDMFVLAFLERFFRPIYKKVPINELLISLLIFFVPPNSLSYLQDDIVLGKKLGEGSFGSVYRVSLARKPS
SKPADLVLKKATEYGAVEIWMNERVRRACANSCADFLYGFRETSSKKGAEYWLLWRFEGEATLADLMQSRDFPYNVESLILREVQDLPKG
LDRENRIILTIMRQLLFALDGLHSTGIVHRDIKPQNIIFSEGSRAFKIIDLGAAADLRVGINYIPKEFLLDPRXFPTLQTDKFVYAQVEI
SCSTHGH
Predicted Coding Sequence 
CGGGCCCCCCTCGAGATAGCTGCAGTGGGGATAGGTGGTGXTAGTACTCCACTCTTCATTTCTGGGGAAGAAAGTGGGGATTTTGAAGCC
TTTATGTTTGTCGATACATTGAAGAAACAATGTAATTTTTCAATTTGCGGTAGCTTTGTACATGATCTTTTTGTTGGAGTTGGGGTAGGA
CTACCCTGTACTGTAATGGAGTGTGGTGATATAATTTATAGAAGCACACTACCCAAGTCAAATGGGATCACAGTGACTGTTCCTGGGGTT
ATTTTGGCTTTGGGTACCCTCTCTTACCTCTGGGCTACTCCTGGTGTTGCTCCTGGTTTCTTTGATATGTTTGTTCTTGCCTTTCTTGAA
AGATTCTTTCGACCTATTTATAAGAAGGTACCTATAAATGAGTTGTTAATTAGTTTACTTATCTTCTTTGTTCCXCCAAATTCTTTATCT
TATCTGCAGGATGATATTGTATTGGGAAAGAAACTGGGTGAGGGATCTTTTGGTTCTGTTTATAGAGTTTCTTTGGCAAGAAAGCCATCA
TCAAAGCCTGCTGATTTAGTCTTAAAAAAAGCAACTGAATATGGAGCAGTGGAAATATGGATGAATGAGCGTGTGCGTAGAGCTTGTGCT
AATAGTTGTGCTGATTTTCTCTATGGTTTTCGAGAGACTTCTTCAAAGAAAGGAGCAGAGTATTGGCTTCTTTGGCGTTTCGAAGGGGAA
GCTACACTTGCTGATTTGATGCAGAGTAGAGACTTTCCCTACAATGTAGAATCATTGATCCTTCGAGAGGTTCAGGACTTGCCCAAAGGT
TTGGATAGAGAAAATAGAATCATATTGACAATTATGAGACAACTCCTATTTGCTTTGGATGGACTTCACTCCACAGGGATAGTACATAGA
GATATTAAGCCTCAAAACATAATTTTCTCTGAAGGTTCTCGCGCGTTCAAAATTATTGATCTTGGTGCTGCAGCAGATTTGAGAGTAGGA
ATCAATTATATTCCTAAGGAGTTTCTTTTAGATCCAAGGTAATTTCCTACTCTGCAAACTGACAAGTTTGTGTATGCACAAGTGGAAATT
TCTTGTTCAACACATGGACATTAA\
Edits in Original Sequence 
(5')CGGGCCCCCCTCGAGATAGCTGCAGTGGGGATAGGTGGTGXTAGTACTCCACTCTTCATTTCTGGGGAAGAAAGTGGGGATTTTGA
AGCCTTTATGTTTGTCGATACgATTGAAGAAACAATGTAATTTTTCAATTTGCGGTAGCTTTGTACATGATCTTTTTGTTGGAGTTGGGG
TAGGACTACCCTGTACTGTAATGGAGTGTGGTGATATAATTTATAGAAGCACACTACCCAAGTCAAATGGGATCACAGTGACTGTTCCTG
GGGTTATTTTGGCTTTGGGTACCCTCTCTTACCTCTGGGCTACTCCTGGTGTTGCTCCTGGTTTCTTTGATATGTTTGTTCTTGCCTTTC
TTGAAAGATTCTTTCGACCTATTTATAAGAAGGTACCTATAAATGAGTTaGTTAATTAGTTTACTTATCTTCTTTGTTCCXCCAAATTCT
TTATCTTATCTGCAGGATGATATTGTATTGGGAAAGAAACTGGGTGAGGGATCTTTTGGTTCTGTTTATAGAGTTTCTTTGGCAAGAAAG
CCATCATCAAAGCCTGCTGATTTAGTCTTAAAAAAAGCAACTGAATATGGAGCAGTGGAAATATGGATGAATGAGCGTGTGCGTAGAGCT
TGTGCTAATAGTTGTGCTGATTTTCTCTATGGTTTTCGAGAGACTTCTTCAAAGAAAGGAGCAGAGTATTGGCTTCTTTGGCGTTTCGAA
GGGGAAGCTACACTTGCTGATTTGATGCAGAGTAGAGACTTTCCCTACAATGTAGAATCATTGATCCTTCGAGAGGTTCAGGACTTGCCC
AAAGGTTTGGATAGAGAAAATAGAATCATATTGACAATTATGAGACAACTCCTATTTGCTTTGGATGGACTTCACTCCACAGGGATAGTA
CATAGAGATATTAAGCCTCAAAACATAATTTTCTCTGAAGGTTCTCGCGCGTTCAAAATTATTGATCTTGGTGCTGCAGCAGATTTGAGA
GTAGGAATCAATTATATTCCTAAGGAGTTTCTTTTAGATCCAAGGTAATTTCCTACTCTGCAAACTGACAAGTTTGTGTATGCACAAGTG
GAAATTTCTTGTTCAACACATGGACATTAA\(3')TAACATCTATATTTTCTATTCTGTGACCTTTGTTTCTTGGAACTAATTATCCCCT
TGATAAAAGTGGCATAATATAATTGTCAGCTCATAACGATGACTTCTTATCATTCTTTTCTGTTATTCATTTCAAAAACATCTCCAATCA
AATTAAATAAAAGAACATGCATTTTCCATCCTTTTTATTATTAGGGTAATGTATATTCTAACCTCAACATCTCAATCTGCGTTTGTTGTT
GCTTTCATGGATTAATTAAGTATGATGCCAATTTGCTCGTCGAATCATGTCCATTTTTCACTTTACATATTTTCTGAATTCAATTTGTTT
TGTTAATCATGCCTTTATTATTTATAACCAGGTGTCCTCAAACCTCCCAATGAACCATCAGTGCTAACCTTATAAGTTCTTGGAAGACTA
CCCAGGAAAATCACTTCATTTTTGAGTGTTAAAAGTGTTCTTTCTATAATGCTCAAGCTAACAAACTGAAACTTGTATGCCTAAATAGAA
AAAAATTCAGGACCCGACAGAGTGATGTCCCTGAAATTGAGTGATGAAATATCAGGATTTTCCAATTTAATGGGTATGTTATGTACCATA
ATGATTGAGTACTTTCCCCGCACATTTTAAAGAGCATTAGATGACTTTGAGATTGGATTTATGGCATGTTTTTGCTTGTTAGTTTTAATT
ATATTAGCTTAATTTACATGAGAGATGCACAGATTATGAATGATCATGTTCCTTATTCAATTATAAAGAAGTGATATTGACTATTGAGAT
TGGTATGATCTCAAAAGTTAATCTTTGTACCATTTAAAGGTGAAGAGAAAATAGATGCATTCTGTGTTACTGATCATCTGTTTTTTGGAA
GACTTTCAGGTAATACCATTTATAACTTGGTATGTTTGCATGGGTGGATCTTTTACTTAGGGATTTAGTTTACTTATTTTTCTAACTGTA
TCTTTTCCGGTCAAGATACGCTGCACCAGAGCAATACATTATGAGCACACAAANCCCTTTCTGCACCGTCTGCTCCAGTTGCAACTGCAC
TTTCCCCCAGTTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan