ESTScan Details for Unigene SGN-U275305

Score 
581
Direction 
Forward
Predicted Peptide Sequence 
LEILARRETISESHSRRRKTGAAPPETVEKYNSRLIYKIIEKIAVEMSNGGATSNPPSRTSIFIRIEEADLKFLAIEQQSDDYVAFKVKT
TNPKKYCVRPNTGIVMPRSTCEVIVTMQAQKEAPPDMQCKDKFLLQSVIVSPGTMAKDITPEMFNKESGNHVEEVKLRVAYVPPQPPPSP
VREGSEEGSSPRASISENGAEFHNASRTYAEPQDNSSETKALILKLSEEKKSAIQQNNKLKQELELLRRESSRRRGGIPFMYVIIVGXGG
PLSWLSSQEDMMAKRLLLHGQCRAKCFKKSRTLKKKVTNPVKLCIISCLVDLKMYKTGFNXVFVMPELESIIV
Predicted Coding Sequence 
CTCGAGATCCTCGCCCGCCGTGAAACTATCTCCGAATCCCACTCCCGTCGCCGGAAAACCGGTGCTGCTCCGCCCGAAACCGTAGAGAAG
TATAATTCCCGGCTGATTTATAAAATTATAGAAAAGATCGCTGTCGAAATGAGTAACGGXGGAGCTACTTCAAATCCACCCAGTAGAACT
TCAATTTTCATTCGAATTGAAGAAGCAGATCTCAAGTTCCTTGCAATTGAGCAACAATCAGATGACTATGTAGCCTTCAAGGTGAAGACG
ACGAATCCAAAGAAGTACTGTGTAAGGCCCAATACTGGAATTGTGATGCCTCGCTCTACCTGTGAAGTCATAGTTACAATGCAAGCACAA
AAAGAGGCACCACCGGACATGCAATGCAAGGATAAGTTCCTGCTTCAAAGTGTCATAGTAAGCCCCGGAACTATGGCTAAGGATATAACT
CCAGAAATGTTCAACAAAGAGTCTGGGAATCATGTTGAAGAGGTCAAGTTGAGAGTGGCTTATGTTCCACCTCAACCACCACCATCACCT
GTGCGGGAGGGGTCCGAGGAAGGTTCCTCACCTAGGGCTTCAATATCTGAAAATGGAGCTGAGTTCCACAATGCTTCAAGGACATATGCT
GAGCCACAAGACAACTCATCAGAGACAAAAGCACTAATTTTGAAGCTGTCAGAGGAGAAAAAATCTGCAATACAGCAAAATAACAAGCTT
AAGCAAGAATTGGAGTTGTTGAGGCGAGAAAGCAGCAGACGTCGTGGCGGAATCCCATTTATGTATGTTATTATTGTTGGAXCTGGTGGG
CCTCTTTCTTGGTTATCTTCTCAAGAAGACATGATGGCTAAGAGGTTGCTGCTACATGGTCAGTGCAGAGCCAAATGTTTTAAAAAATCT
AGAACCTTGAAGAAAAAGGTGACTAATCCAGTAAAGCTTTGTATCATTAGTTGTCTGGTTGACTTAAAAATGTACAAGACAGGTTTTAAT
XCTGTTTTTGTAATGCCTGAGCTCGAGAGTATCATCGTGTGA\
Edits in Original Sequence 
(5')CTCGAGATCCTCGCCCGCCGTGAAACTATCTCCGAATCCCACTCCCGTCGCCGGAAAACCGGTGCTGCTCCGCCCGAAACCGTAGt
AGAAGTATAATTCCCGGCTGATTTATAAAATTATAGAAAAGATCGCTGTCGAAATGAGTAACGGXGGAGCTACTTCAAATCCACCCAGTA
GAACTTCAATTTTCATTCGAATTGAAGAAGCAGATCTCAAGTTCCTTGCAATTGAGCAACaAATCAGATGACTATGTAGCCTTCAAGGTG
AAGACGACGAATCCAAAGAAGTACTGTGTAAGGCCCAATACTGGAATTGTGATGCCTCGCTCTACCTGTGAAGTCATAGTTACAATGCAA
GCACAAAAAGAGGCACCACCGGACATGCAATGCAAGGATAAGTTCCTGCTTCAAAGTGTCATAGTAAGCCCCGGAACTATGGCTAAGGAT
ATAACTCCAGAAATGTTCAACAAAGAGTCTGGGAATCATGTTGAAGAGGTCAAGTTGAGAGTGGCTTATGTTCCACCTCAACCACCACCA
TCACCTGTGCGGGAGGGGTCCGAGGAAGGTTCCTCACCTAGGGCTTCAATATCTGAAAATGGAGCTGAGTTCCACAATGCTTCAAGGACA
TATGCTGAGCCACAAGACAACTCATCAGAGACAAAAGCACTAATTTTGAAGCTGTCAGAGGAGAAAAAATCTGCAATACAGCAAAATAAC
AAGCTTAAGCAAGAATTGGAGTTGTTGAGGCGAGAAAGCAGCAGACGTCGTGGCGGAATCCCATTTATGTATGTTATTATTGTTGGAXCT
GGTGGGCCTCTTTCTTGGTTATCTTCTCAAGAAGACATGATGGCTAAGAGGTTGCTGCTACATGGTCAGTGCAGAGCCAAATGTTTTAAA
AAATCTAGAACCTTGAAGAAAAAGGTGACTAATCCAGTAAAGCTTTGTATCATTAGTTGTCTGGTTGACTTAAAAATGTACAAGACAGGT
TTTAATXCTGTTTTTGTAATGCCTGAGCTCGAGAGTATCATCGTGTGA\(3')CTAACTGCATTTGACATCCTTTGCCAACATGTGAAGG
AGACATTTTAGTTTGCTAATTAAGTATACTTCCTGTTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan