ESTScan Details for Unigene SGN-U275426

Score 
71
Direction 
Forward
Predicted Peptide Sequence 
DLLHFNIQVVGKKYVRLYSASLSDELHPHSETMLSNSSQVDLDNIDEKEFPNILDLEFQDCILEEGEMLYIPPKWWHYSALSRQAFQLAF
GGXDAEKLDD
Predicted Coding Sequence 
GATCTTCTGCATTTCAATATACAGGTTGTTGGCAAAAAGTATGTACGGCTTTACTCAGCGTCACTTTCGGATGAGCTTCACCCACATAGT
GAAACCATGCTTAGCAATTCCAGCCAGGTTGATCTAGACAACATTGACGAGAAAGAGTTCCCAAATATATTAGACCTGGAATTCCAGGAC
TGTATTTTAGAGGAAGGTGAGATGCTTTACATTCCCCCTAAATGGTGGCACTACTCCGCTCTCTCACGACAAGCTTTTCAGTTAGCTTTT
GGTGGAGXTGATGCTGAAAAATTAGACGACTGA\
Edits in Original Sequence 
TTTTACAATAAGCTTCCTGAGCTTAACAAAAAATAAATCAGGTTGAACCATAGGTGATTGGTTTGATTGATTATTTTTTAGGGGGGAAAG
TTTCTGCTACTGTGTGCATGTTGATATGTTTCATTTTTATTTCTTGT
(5')GATCTTCTGCATTTCAATATACAGGTTGTTGGCAAAAAG
TATGTACGGCTTTACTCAGCGTCACTTTCGGATGAGCTTCACCCACATAGTGAAACCATGCTTAGCAATTCCAGCCAGGTTGATCTAGAC
AACATTGACGAGAAAGAGTTCCCAAATATATTAGACCTGGAATTCCAGGACTGTATTTTAGAGGAAGGTGAGATGCTTTACATTCCCCCT
AAATGGTGGCACTACgTCCGCTCTCTCACGACAAGCTTTTCAGTTAGCTTTTGGTGGAGXTGATGCTGAAAAATTAGACGACTGA\(3')
TCGGTCTCGTCTCGTGTATACAAAGGAACCAGTTCAACTATCATTCTTCTGCAGATAGCAATGTGGACTTCACCACTACTAATACATTTA
ACTGTCATTGTCCAGTGTGATTGTTTCAGCTCCAAGTAGCCTTGTTGCTTTATTACTTGAAGGTTCGTCTGATCATTATCATGAATTTGG
TAAATAAGGTGAAAATGATTTTTTTCTTTGGAACTGAGGTATAGTTATTGTTGTAGGATTTCGCGAGATGAAATGATAAAAAGGCTCAGA
ATTGTTGGTTTAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan