ESTScan Details for Unigene SGN-U275518

Score 
224
Direction 
Forward
Predicted Peptide Sequence 
MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKVCSYFVTFLTILSPSXECHVLCDATNARNCFQANVRSYYLKLEEEQTQILIDQKIKERL
GQAVAYQQIGAAYNQHLAAFPGQRPRLPMMPPPMLPVPGADAPTINX
Predicted Coding Sequence 
ATGCCTCGGTATTACTGTGACTATTGTGACACTTACTTGACACATGATTCGCCGTCTGTCAGAAAACAGCATAATGCCGGTTACAAACAC
AAGGTGTGTTCATATTTTGTAACTTTTCTGACAATCCTGTCTCCTAGCXGTGAATGTCATGTTCTCTGTGATGCTACTAATGCTAGGAAT
TGTTTTCAGGCTAATGTCCGATCTTATTACTTGAAGCTTGAGGAGGAGCAAACACAGATTCTGATAGATCAGAAAATCAAGGAGCGCCTT
GGGCAGGCAGTAGCCTACCAACAAATAGGTGCAGCTTATAATCAACATCTTGCTGCTTTCCCTGGTCAACGACCCCGCCTACCTATGATG
CCACCTCCTATGCTGCCTGTTCCAGGAGCXGATGCCCCCACAATTAATGXX\
Edits in Original Sequence 
ATTCATATCAGTTACAATTCTCCGACGACCTTCCCGGCGAATAACTTTTGTACAGAATTCGCCAATTTCATTGGCAAAGTAACTCTTTCC
TTTTGTTAAATCA
(5')ATGCCTCGGTATTACTGTGACTATTGTGACACTTACTTGACACATGATTCGCCGTCTGTCAGAAAACAGCATA
ATGCCGGTTACAAACACAAGGTGTGTTCATATTTTGTAACTTTTCTGACAATCCTGTCTCCTAGCXGTGAATGTCATGTTCTCTGTGATG
CTACTAATGCTAGGAATTGTTTTCAGGCTAATGTCCGATCTTATTACTTGAAGCTTGAGGAGGAGCAAACACAGATTCTGATAGATCAGA
AAATCAAGGAGCGCCTTGGGCAGGCAGTAGCCTACCAACAAATAGGTGCAGCTTATAATCAACATCTTGCTGCTTTCCCTGGTCAACGAC
CCCGCCTACCTATGATGCCACCTCCTATGCTGCCTGTTCCAGGAGCXGATGCCCCCACAATTAATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan