ESTScan Details for Unigene SGN-U275686

Score 
28
Direction 
Forward
Predicted Peptide Sequence 
ITYLLSFALKVVAFFGIQFTXAGPNLCVYREIEGFPALYGNLSEKKSLDLTGFTWYDYHALLLAQEYELIEEXTFFVEPKTGALVVINEV
RQYREISNSNNNETTDGGTTTNRSNIS
Predicted Coding Sequence 
ATTACATATCTTCTCTCTTTTGCTCTCAAAGTTGTTGCATTTTTTGGAATTCAGTTTACTXCTGCCGGCCCGAATCTGTGTGTATACCGT
GAAATTGAGGGATTTCCAGCATTGTATGGCAATCTCAGCGAAAAGAAGTCTTTGGATCTCACTGGCTTCACATGGTATGACTATCACGCC
TTGCTGCTCGCACAAGAATATGAGCTGATTGAGGAGXTAACATTTTTTGTTGAGCCCAAGACTGGGGCXTTAGTTGTTATTAATGAAGTG
CGTCAGTATCGTGAGATCTCAAATTCAAACAACAATGAAACAACAGATGGGGGCACTACCACTAACAGAAGCAACATTAGTTAA\
Edits in Original Sequence 
(5')ATTACATATCTTCTCTCTTTTGCTCTCAAAGTTGTTGCATTTTTTGGAATTCAGTTTACTXCTGCCGGCCCGAATCTGTGTGTATA
CCGTGAAATTGAGGGATTTCCAGCATTGTATGGCAATCTCAGCGtAAAAGAAGTCTTTGGATCTCACTGGCTTCACATGGTATGACTATC
ACGCCTTGCTGCTCGCACAAGAATATGAGCTgGATTGAGGAGXTAACATTTTTTGTTGAGCCCAAGACTGGGGCXTTAGTTaGTTATTAA
TGAAGTGCGTCtAGTATCGTGAGATCTCAAATTCAAACAACAATGAAACAACAGATGGGGGCACTACCACTAACAGAAGCAACATTAGTT
AA\(3')GTTATAGTATGTCACGCAAGAACACTTAATCTGATAATTTTATCACTTTTCGCCCTTCAGGTTGCCTGTTCGAAACTTGCCAC
CCCTAGGTATATGCGGGTCAAATTATGTGTAATTTATACTAGATATACTAATATCTAAGCGTGATTTGTATGTATATGAGATACACTAGC
TCTCTCGCTTGTATCTCTCCCTCTCTTGCTCGCCTCTCCCCAATATATCTGAGTTTTACAAATTGTATGTATTTGTGTAACGAGAATCAA
TTCCATTTATCTGTGTAAAACAAGAAAAAAAAAAAACTCGAGGGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan