ESTScan Details for Unigene SGN-U275723

Score 
759
Direction 
Forward
Predicted Peptide Sequence 
KIEKCMGDPNADEDNPVVKEEQDAQIGKGTRGDVTILPTLVVNNRQYRGKLEKGAVLKAICAGFEETTEPAVCLSDDVETNECLDNNGGC
WQDKAANITACKDTFRGRVCECPVVDGVQFKGDGYALVPQVDVGDANSTMEAVGITXQDGHTFSACVDNEEGKCSCPPGFKGDGVKSCED
IDECREKKDVNALNAAAKIRGAVMSAVAVGNYCXIRDHDTCISKRAMEVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIM
AQYMPLDSQSEVQNHVNEDHAEIDIVMPPDIQNEXPNVAKLALQMENIVSNYSSENLDEVADSIASVSDKETEGKXLTSVIYSG
Predicted Coding Sequence 
XGAAAGATTGAGAAGTGTATGGGAGACCCTAATGCTGATGAGGACAACCCCGTTGTGAAAGAAGAGCAGGATGCCCAAATTGGTAAAGGA
ACCAGAGGAGACGTCACCATATTACCTACTCTTGTTGTCAACAATCGACAATATCGAGGGAAATTGGAGAAGGGTGCTGTTTTAAAGGCT
ATTTGTGCTGGTTTTGAGGAGACTACTGAGCCTGCAGTTTGTTTGAGCGATGATGTGGAGACAAATGAATGCCTGGATAATAATGGTGGC
TGCTGGCAAGACAAGGCTGCTAATATCACTGCCTGCAAGGACACATTTCGTGGTAGAGTGTGTGAATGTCCTGTGGTTGATGGTGTTCAG
TTCAAAGGAGATGGTTATGCTCTTGTACCGCAAGTGGACGTGGGCGATGCAAACTCAACAATGGAGGCTGTTGGCATCACAXCTCAAGAT
GGTCACACTTTCTCTGCTTGTGTGGATAACGAGGAGGGCAAGTGCTCATGTCCTCCAGGGTTTAAAGGTGATGGTGTTAAAAGCTGTGAA
GATATTGATGAATGTAGAGAAAAGAAAGATGTCAATGCCCTGAATGCAGCTGCAAAAATACGTGGGGCAGTTATGAGTGCAGTTGCAGTG
GGGAACTACTGTXACATCAGAGACCATGATACCTGCATAAGCAAGAGAGCTATGGAAGTCAAATCAGCATGGGCTGCAGTTTGGGCTATT
TTGATTGGATTGGCTATGGCTGGTGGTGGCGCATATCTTGTGTACAAATACAGATTAAGGTCATACATGGATTCAGAGATCAGGGCTATT
ATGGCACAATATATGCCGCTGGACAGCCAAAGTGAAGTCCAAAATCACGTCAACGAGGATCATGCTGAAATAGATATCGTCATGCCACCA
GATATCCAAAATGAAGXTCCAAATGTTGCCAAGCTCGCATTGCAGATGGAAAATATTGTCAGTAATTATTCTTCTGAGAATTTGGATGAA
GTGGCAGATTCAATTGCTTCTGTTTCTGATAAAGAAACTGAAGGTAAAXTTCTTACGTCTGTTATATACAGTGGATAATAA\
Edits in Original Sequence 
(5')XGAAAGATTGAGAAGTGTATGGGAGACCCTAATGCTGATGAGGACAACCCCGTTGTGAAAGAAGAGCAGGATGCCCAAATTGGTAA
AGGAACCAGAGGAGACGTCACCATATTACCTACTCTTGTTGTCAACAATCGACAATATCGAGGGAAATTGGAGAAGGGTGCTGTTTTAAA
GGCTATTTGTGCTGGTTTTGAGGAGACTACTGAGCCTGCAGTTTGTTTGAGCGATGATGTGGAGACAAATGAATGCCTGGATAATAATGG
TGGCTGCTGGCAAGACAAGGCTGCTAATATCACTGCCTGCAAGGACACATTTCGTGGTAGAGTGTGTGAATGTCCTGTGGTTGATGGTGT
TCAGTTCAAAGGAGATGGTTATaGCTCTTGTACCGCAAGTGGACGTGGGCGATGCAAACTCAACAATGGAGGCTGTTGGCATCACAXCTC
AAGATGGTCACACTTTCTCTGCTTGTGTGGATAACGAGGAGGGCAAGTGCTCATGTCCTCCAGGGTTTAAAGGTGATGGTGTTAAAAGCT
GTGAAGATATTGATGAATGTAGAGAAAAGAAAGcATGTCAATGCCCTGAATGCAGCTGCAAAAATACGTGGGGCAGTTATGAGTGCAGTT
GCAGTGGGGAACTACTGTXACATCAGAGACCATGATACCTGCATAAGCAAGAGAGCTATGGAAGTCAAATCAGCATGGGCTGCAGTTTGG
GCTATTTTGATTGGATTGGCTATGGCTGGTGGTGGCGCATATCTTGTGTACAAATACAGATTAAGGTCATACATGGATTCAGAGATCAGG
GCTATTATGGCACAATATATGCCGCTGGACAGCCAAAGTGAAGTCCAAAATCACGTCAACGAGGATCATGCtTGAAATAGATATCGTCAT
GCCACCAGATATCCAAAATGAAGXTCCAAATGTTGCCAAGCTCGCATTGCAGATGGAAAATATTGTCAGTAATTATTCTTCTGAGAATTT
GGATGAAGTGGCAGATTCAATTGcCTTCTGTTTCTGATAAAGAAACTGAAGGTAAAXTTCTTACGTCTGTTATATACAGTGGATAATAA\
(3')AGACAACATAGGATTGTTTCTTTCTTTTAATTTATCTTCTATTCCCTCTCATTTTATGTATCGTTGAGGGTCTTGTAATGTTGTAG
GCTGATTTAGGGTCAGGATAAAGAGTTTGTGGTGTAGGATTTGCAGCTGTATCGCCATAAATTTAATTTGGTGCATGCAATCGTTAAAAA
AAAAAAAAAAAAACTCGAGGGGGGGGCCCGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan