ESTScan Details for Unigene SGN-U275777

Score 
566
Direction 
Forward
Predicted Peptide Sequence 
MANELLILSNALQKCQGEREEVKAAVTXDLAFAFLSAQISENIMKLQPLLAAIAFLILLLSVFLHVIADLDSDRQALLDFAESVPHIRKL
NWNLALPICKSWAGIACNKDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRANYLNGSVPSDLLSIPSLQSVYLQHNSFSGDIPVS
LSPRLGVLDLSFNSFTGEIPPTIKNLTRLSVLNLQFNSLTGEIPSLDTLRLTNLNLSYNMLNGSVPDPLQKFPLTSFAGNSHLCGTPLNS
CSSSPSPSPAADGSAIPEKQKAVHSKKLSTGIIIX
Predicted Coding Sequence 
ATGGCTAATGAGCTXCTGATTTTGTCTAATGCTCTTCAAAAATGTCAAGGAGAGAGGGAAGAAGTGAAGGCTGCTGTAACTAXGGATCTT
GCTTTTGCATTTTTGTCAGCXCAGATCAGTGAAAACATAATGAAGCTTCAGCCTTTACTGGCAGCTATTGCTTTTCTTATTCTGCTGCTA
TCAGTATTTCTTCATGTTATAGCTGATCTTGATTCCGATAGACAGGCGCTACTCGACTTTGCAGAATCTGTCCCTCATATACGAAAACTC
AACTGGAATTTGGCTCTCCCTATTTGCAAATCTTGGGCTGGTATAGCTTGTAACAAAGATGGAACGAGAGTCATTGCAATCCATCTCCCT
GCTGTAGGACTTTTTGGTCCTATCCCAGCTAATAGTATAGGCAAGCTAGATGCTCTTAAAGTCCTTAGTCTAAGAGCCAATTATCTTAAT
GGAAGTGTTCCTTCTGATCTCCTTTCGATACCGTCTCTCCAATCTGTCTACCTTCAGCATAATAGCTTCTCTGGTGATATTCCTGTTTCT
TTATCTCCTCGTCTTGGTGTACTAGATCTCTCCTTTAACTCTTTTACTGGAGAAATTCCCCCCACAATCAAGAACTTGACGCGATTATCT
GTGCTGAACCTTCAATTCAATTCATTGACAGGAGAAATCCCCAGCCTTGACACCCTCAGGTTAACTAACCTGAATTTGAGTTACAATATG
CTAAATGGCTCCGTTCCAGACCCCCTCCAGAAGTTTCCACTCACATCATTCGCAGGAAACTCTCATTTATGTGGTACACCTCTAAATAGC
TGTTCCTCGTCCCCGTCACCTTCTCCAGCAGCTGATGGCTCTGCAATCCCTGAAAAACAGAAGGCTGTCCACTCTAAGAAACTAAGTACC
GGAATCATCATTGXX\
Edits in Original Sequence 
GTATCTGTCATAATTCTTGCCTACTGGATTGATCCATTTTCAATATGAAGAGGTAGTAAATCAAATGAAGTTTCCCTTTCATTGAACAAC
ACAACTCTCAGATCCCTTTCATGCATATCATATAAA
(5')ATGGCTAATGAGCTXCTGATTTTGTCTAATGCTCTTCAAAAATaGTCAAG
GAGAGAGGGAAGAAGTGAAGGaCTGCTGTAACTAXGGATCTTGCTTTTGCATTTTTGTCAGCXCAGATCAGTGAAAACATAATGAAGCTT
CAGCCTTTACTGGCAGCTATTGCTTTTCTTATTCTGCTGCTATCAGTATTTCTTCATGTTATAGCTGATCTTGATTCCGATAGACAGGCG
CTACTCGACTTTGCAGAATCTGTCCCTCATATACGAAAACTCAACTGGAATTTGGCTCTCCCTATTTGCAAATCTTGGGCTGGTATAGCT
TGTAACAAAGATGGAACGAGAGTCATTGCAATCCATCTCCCTGCTGTAGGACTTTTTGGTCCTATCCCAGCTAATAGTATAGGCAAGCTA
GATGCTCTTAAAGTCCTTAGTCTAAGAGCCAATTATCTTAATGGAAGTGTTCCTTCTGATCTCCTTTCGATACCGTCTCTCCAATCTGTC
TACCTTCAGCATAATAGCTTCTCTGGTGATATTCCTGTTTCTTTATCTCCTCGTCTTGGTGTACTAGATCTCTCCTTTAACTCTTTTACT
GGAGAAATTCCCCCCACAATCAAGAACTTGACGCGATTATCTGTGCTGAACCTTCAATTCAATTCATTGACAGGAGAAATCCCCAGCCTT
GACACCCTCAGGTTAACTAACCTGAATTTGAGTTACAATATGCTAAATGGCTCCGTTCCAGACCCCCTCCAGAAGTTTCCACTCACATCA
TTCGCAGGAAACTCTCATTTATGTGGTACACCTCTAAATAGCTGTTCCTCGTCCCCGTCACCTTCTCCAGCAGCTGATGGCTCTGCAATC
CCTGAAAAACAGAAGGCTGTCCACTCTAAGAAACTAAGTACCGGAATCATCATTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan