ESTScan Details for Unigene SGN-U275781

Score 
1040
Direction 
Forward
Predicted Peptide Sequence 
QESSEAQHPSISDESTLNAANSSSELKVWQRINSANRYNLAEAXPLEKQGFGTGFQQTDTQPAERSSDSNTPSKTGPMESLDAALRGKPK
RLDQPKKEASSVSKEDMRPVKSEGYGNASEIENFLAKSSTKEHEDNDWVRAEELVKSGGREDVELVSCSTRGFVVSFGSLIGFLPYRNLA
ARWKFLAFESWLRQKGLDPSQYKQGLGIIGGYDGFGKAASPEAGVDPQIAKNADEEISPDMKLEDLLKIYDQEKLKFLSSFVGLRIRVSV
VLADRYXQKANILDKGKRKGRIGREEEEPYGKTSGWGRGKMLHTKNYLFGIFVEVEGVLALIHQTEVSWDATLDPTSYFKIGQIVEAKVH
QLDFSLERIFLSLKEITPDPMMEALEAVVGDHDNLNGELQASELDTEWPDVESLIKELQQFEGISSVSKGRYFLSPGLAPTFQVYMASMF
ENQYKLLARSGNRVQEVIVETSLNKEEMKSQFNLVQTKLNNQSKRNNNNTKRVTVEKTNGGKGXDTELAESEVRTAETEKRNDLNRVLF
Predicted Coding Sequence 
CAAGAATCTTCCGAGGCTCAGCATCCTAGTATTTCGGATGAAAGTACTTTGAATGCTGCTAACTCTTCTTCTGAGCTTAAAGTATGGCAG
AGAATAAACTCCGCCAACCGTTACAATCTAGCAGAAGCAXATCCTCTTGAGAAGCAAGGCTTTGGTACAGGATTCCAGCAGACTGATACA
CAGCCTGCTGAGAGAAGTTCTGATTCCAATACACCTTCTAAGACTGGACCCATGGAATCTTTGGATGCTGCTCTTCGTGGAAAACCGAAA
AGATTAGACCAACCTAAAAAGGAAGCATCAAGTGTTAGTAAGGAGGATATGCGCCCTGTCAAATCTGAGGGCTATGGAAATGCTTCAGAG
ATTGAAAACTTCCTGGCAAAATCATCCACTAAGGAACATGAAGATAATGACTGGGTAAGAGCTGAAGAGCTTGTTAAGAGTGGAGGAAGA
GAGGATGTGGAACTAGTCAGCTGTAGCACCAGAGGCTTTGTTGTATCTTTTGGTTCCTTGATAGGATTTTTGCCATATCGCAATCTTGCA
GCCAGGTGGAAATTCTTAGCTTTTGAATCTTGGTTGAGGCAAAAAGGCTTGGATCCATCCCAGTACAAGCAAGGTCTGGGGATCATTGGA
GGCTATGATGGTTTTGGCAAGGCAGCTTCTCCTGAGGCAGGAGTAGATCCGCAAATTGCTAAAAATGCCGATGAGGAGATCTCGCCAGAT
ATGAAACTTGAAGATCTTCTCAAGATTTATGACCAAGAGAAACTCAAGTTCTTATCATCATTTGTTGGTCTGAGGATCAGAGTAAGTGTG
GTGTTGGCTGACAGATATXTCCAGAAGGCTAATATTCTCGATAAAGGCAAAAGAAAAGGAAGAATTGGTCGAGAAGAAGAGGAGCCTTAT
GGCAAAACTTCAGGTTGGGGACGTGGTAAAATGTTGCATACAAAAAATTACCTTTTCGGTATATTTGTCGAGGTTGAAGGAGTACTTGCG
CTAATTCACCAGACAGAAGTCTCATGGGATGCCACTTTAGACCCTACGTCATATTTTAAAATTGGCCAGATTGTGGAGGCAAAAGTTCAT
CAGTTAGACTTTTCACTTGAGCGCATCTTCTTGTCGTTGAAGGAAATAACGCCAGATCCCATGATGGAGGCCTTGGAGGCTGTAGTTGGT
GATCATGACAATTTGAATGGAGAACTCCAAGCATCAGAGCTGGATACTGAGTGGCCTGACGTGGAGTCTCTTATCAAAGAATTACAGCAG
TTCGAGGGTATCTCCTCTGTATCAAAAGGGAGGTACTTCTTGAGTCCTGGTTTGGCTCCAACATTTCAGGTTTATATGGCATCCATGTTT
GAGAATCAATACAAGTTACTTGCTCGGTCGGGAAATAGAGTACAAGAGGTGATAGTGGAGACATCATTGAATAAAGAGGAAATGAAATCT
CAATTCAATCTTGTACAAACAAAGTTGAATAACCAATCAAAACGTAATAATAATAATACGAAGAGAGTGACCGTGGAGAAAACGAACGGT
GGTAAGGGTXCTGATACCGAATTAGCAGAGTCGGAAGTTAGAACAGCAGAAACGGAGAAAAGAAATGACCTAAACCGCGTTCTATTTTGA
\
Edits in Original Sequence 
(5')CAAGAATCTTCCGAGGCTCAGCATCCTAGTATTTCGGATGAAAGTACTTTGAATGCTGCTAACTCTTCTTCTGAGCTTAtAAGTAT
GGCAGAGAATAAACTCCGCCAACCGTTACAATCTAGCAGAAGCAXATCCTCTTGAGAAGCAAGGCTTTGGTACAGGATTCCAGCAGACTG
ATACACAGCCTGCTGAGAGAAGTTCTGATTCCAATACACCTTCTAAGACTGGACCCATGGAATCTTTGGATGCTGCTCTTCGTGGAAAAC
CGAAAAGATTAGACCAACCTAAAAAGGAAGCATCAAGTGTTAGTAAGGAGGATATGCGCCCTGTCAAATCTGAGGGCTATGGAAATGCTT
CAGAGATTGAAAACTTCCTGGCAAAATCATCCACTAAGGAACATGAAGATAATGACTGGGTAAGAGCTGAAGAGCTTGTTAAGAGTGGAG
GAAGAGAGGATGTGGAACTAGTCAGCTGTAGCACCAGAGGCTTTGTTGTATCTTTTGGTTCCTTGATAGGATTTTTGCCATATCGCAATC
TTGCAGCCAGGTGGAAATTCTTAGCTTTTGAATCTTGGTTGAGGCAAAAAGGCTTGGATCCATCCCAGTACAAGCAAGGTCTGGGGATCA
TTGGAGGCTATGATGGTTTTGGCAAGGCAGCTTCTCCTGAGGCAGGAGTAGATCCGCAAATTGCTAAAAATGCCGATGAGGAGATCTCGC
CAGATATGAAACTTGAAGATCTTCTCAAGATTTATGACCAAGAGAAACTCAAGTTCTTATCATCATTTGTTGGTCTGAGGATCAGAGTAA
GTGTGGTGTTGGCTGACAGATATXTCCAGAAGGCTAATATTCTCGATAAAGGCAAAAGAAAAGGAAGAATTGGTCGAGAAGAAGAGGAGC
CTTATGGCAAAACTTCAGGTTGGGGACGTGGTAAAATGTTGCATACAAAAAATTACCTaTTTCGGTATATTTGTCGAGGTTGAAGGAGTA
CTTGCGCTAATTCACCAGACAGAAGTCTCATGGGATGCCACTTTAGACCCTACGTCATATTTTAAAATTGGCCAGATTGTGGAGGCAAAA
GTTCATCAGTTAGACTTTTCACTTGAGCGCATCTTCTTGTCGTTGAAGGAAATAACGCCAGATCCCATGATGGAGGCCTTGGAGGCTGTA
GTTGGTGATCATGACAATTTGAATGGAGAACTCCAAGCATCAGAGCTGGATACTGAGTGGCCTGACGTGGAGTCTCTTATCAAAGAATTA
CAGCAGTTCGAGGGTATCTCCTCTGTATCAAAAGGGAGGTACTTCTTGAGTCCTGGTTTGGCTCCAACATTTCAGGTTTATATGGCATCC
ATGTTTGAGAATCAATACAAGTTACTTGCTCGGTCGGGAAATAGAGTACAAGAGGTGATAGTGGAGACATCATTGAATAAAGAGGAAATG
AAATCTgCAATTCAATCTTGTACAAACAAAGTTGAATAACCAATCAAAACGTAATAATaAATAATACGAAGAGAGTGACCGTGGAGAAAA
CGAACGGaTGGTAAGGGTXCTGATACCGAATTAGCAGAGTCGGAAGTTAGAACAGCAGAAACGGAGAAAAGAAATGACCTAAACCGCGTT
CTATTTTGA\(3')ACGAAAATGGTATTAATTTTTATTGTTTTGCCTTTGACATCAATAAGTTAGGAGCTTATTTACTTGCTAGTAAGTG
CTTTATGTTTAAGCATCGATGTAATACGCTTAAACATCAATCGATTACGCTTCAATATCAAATGAGTTGTGGTCGACTAAAAAAAAAAAA
A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan