ESTScan Details for Unigene SGN-U275792

Score 
715
Direction 
Forward
Predicted Peptide Sequence 
MEVEVEAAAAAEREATNSVICQLADPEGNPLGAALYLPENASPKELNQVVNKLLSNEEKLPYAFYISDEELVVQLGSYLEKNKVSVEKVL
TIVYQPQAVFRIRPVTRCSATIAGHTEAVLSVAFSPDGRQLASGSGDTTVRLWDLNTQTPLFTCQGHRNWVLSVAWSPDGKHLVSGSKAG
ELICWDLQTGKPLGNPLTGHKKWITGISWEPVHLSAPCRRFVSASKDGDARIWDVTTRKCLICLTGHTLAITCVKWGGDGVIYTGSQDCT
IKXMGNHAGEANTELKGHGHWVNSLALSTEYVLRSGAFDHTHKHFASPEEMKKVALERYNKMRGNAPERLVSGSDDFTMFLWEPAVSKHP
KTRMTGHQQLVNHVYFSPDGQWIASASFDKSVKLWX
Predicted Coding Sequence 
ATGGAAGTGGAAGTGGAAGCTGCGGCGGCGGCAGAGAGAGAAGCAACAAACAGTGTCATATGTCAGTTGGCAGACCCAGAAGGCAATCCG
TTGGGTGCCGCCTTGTACCTCCCTGAAAACGCCAGTCCAAAAGAGCTTAATCAAGTCGTCAATAAGCTTCTCAGCAATGAGGAAAAGTTG
CCTTATGCATTTTATATCTCAGACGAAGAGCTTGTGGTGCAGCTTGGATCATACTTAGAGAAGAACAAAGTGTCTGTGGAAAAAGTCTTG
ACAATAGTTTATCAACCACAAGCAGTGTTTCGAATCCGCCCTGTCACTCGTTGTTCGGCCACAATTGCTGGTCACACTGAAGCTGTTCTT
TCAGTTGCCTTCAGTCCTGATGGACGACAGTTGGCAAGTGGATCTGGTGACACTACAGTTCGTTTGTGGGATCTAAATACCCAGACACCA
TTGTTTACATGTCAAGGGCACAGAAATTGGGTTCTTTCTGTTGCATGGTCGCCAGATGGTAAGCATCTTGTTAGTGGAAGCAAGGCTGGA
GAACTTATCTGTTGGGACCTTCAGACTGGGAAGCCTTTAGGGAATCCGCTTACTGGCCACAAGAAATGGATAACTGGTATTTCTTGGGAA
CCTGTACACCTCAGTGCTCCATGTCGCCGCTTTGTAAGTGCAAGTAAAGATGGCGATGCACGGATATGGGATGTTACCACAAGGAAGTGT
CTCATTTGTCTCACTGGCCATACACTTGCAATAACATGTGTAAAATGGGGTGGAGATGGAGTTATATACACGGGATCTCAGGACTGTACA
ATCAAGGXTATGGGAAACCACGCAGGGGAAGCTAATACTGAATTGAAGGGTCATGGACATTGGGTAAATTCTCTAGCACTGAGCACTGAA
TATGTTCTTCGAAGTGGAGCTTTTGATCACACCCATAAACACTTCGCATCTCCTGAGGAAATGAAAAAGGTAGCACTTGAAAGGTACAAC
AAAATGAGAGGTAATGCCCCTGAGAGGTTGGTATCAGGATCAGATGATTTCACAATGTTTCTATGGGAGCCTGCTGTCAGCAAGCACCCA
AAAACTCGCATGACAGGTCATCAACAGCTGGTTAATCACGTTTATTTTTCTCCCGATGGTCAATGGATAGCAAGTGCCTCATTCGATAAG
TCAGTAAAATTATGGGAX\
Edits in Original Sequence 
TAAGAGTCAAAAGTAGTCTTAACCAGAAAATTTGTAAGCGAAGATTAATGGCAGAAACG(5')ATGGAAGTGGAAGTGGAAGCTGCGGCG
GCGGCAGAGAGAGAAGCAACAAACAGTGTCATATGTCAGTTGGCAGACCCAGAAGGCAATCCGTTGGGTGCCGCCTTGTACCTCCCTGAA
AACGCCAGTCCAAAAGAGCTTAATCAAGTCGTCAATAAGCTTCTCAGCAATGAGGAAAAGTTGCCTTATGCATTTTATATCTCAGACGAA
GAGCTTGTGGTGCAGCTTGGATCATACTTAGAGAAGAACAAAGTGTCTGTGGAAAAAGTCTTGACAATAGTTTATCAACCACAAGCAGTG
TTTCGAATCCGCCCTGTCACTCGTTGTTCGGCCACAATTGCTGGTCACACTGAAGCTGTTCTTTCAGTTGCCTTCAGTCCTGATGGACGA
CAGTTGGCAAGTGGATCTGGTGACACTACAGTTCGTTTGTGGGATCTAAATACCCAGACACCATTGTTTACATGTCAAGGGCACAGAAAT
TGGGTTCTTTCTGTTGCATGGTCGCCAGATGGTAAGCATCTTGTTAGTGGAAGCAAGGCTGGAGAACTTATCTGTTGGGACCTTCAGACT
GGGAAGCCTTTAGGGAATCCGCTTACTGGCCACAAGAAATGGATAACTGGTATTTCTTGGGAACCTGTACACCTCAGTGCTCCATGTCGC
CGCTTTGTAAGTGCAAGTAAAGATGGCGATGCACGGATATGGGATGTTACCACAAGGAAGTGTCTCATTTGTCTCACTGGCCATACACTT
GCAATAACATGTGTAAAATGGGGTGGAGATGGAGTTATATACACGGGATCTCAGGACTGTACAATCAAGGXTATGGGAAACCACGCAGGG
GAAGCTAATACgTGAATTGAAGGGTCATGGACATTGGGTAAATTCTCTAGCACTGAGCACTGAATATGTTCTTCGAAGTGGAGCTTTTGA
TCACACCCATAAACACTTCGCATCTCCTGAGGAAATGAAAAAGGTAGCACTTGAAAGGTACAACAAAATGAGAGGTAATGCCCCTGAGAG
GTTGGTATCAGGATCAGATGATTTCACAATGTTTCTATGGGAGCCTGCTGTCAGCAAGCACCCAAAAACTCGCATGACAGGTCATCAACA
GCTGGTTAATCACGTTTATTTTTCTCCCGATGGTCAATGGATAGCAAGTGCCTCATTCGATAAGTCAGTAAAATTATGGGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan