ESTScan Details for Unigene SGN-U275805

Score 
943
Direction 
Reverse
Predicted Peptide Sequence 
FFLAVITNYLDEKQKLLCGFSVPVYKVNTNQGNFKTSLTMIRAMGLLQSWGGFGTSIASFIFLRDMIRRYCPPELIRAFDKWTRRIRSFF
YPYIQISISEFMSNNLKPHDAYAAVEAYLSVHLAKDAKRLRAETVTGGSKLVLSMDEHEKVTDEFCGVKVQWISGKLVQRESKYLPELER
KYYKLMFHKKYRDMVTDIYLEQVIKAGKEIQMRNRKRKLYTNNGHSKTTWSHIVFEHPATFGSLAMEAAKKQEIMDDLLLFRDSKGFLCK
DWQGVKAVVIYYIVPPGTGKSTMIAAMANYWIYDVCDLELTSVRDNTELRRLLAETTSKSIIVIEDIDCSLDLTGQRKKKPPEEKIEKTK
KEVSRKDTEESGSRVTLSGLLNFIDGLWSACSGERIIVFTTNYVDKLDPALTRRGRMDKHIELSYCSFDGFKVLAKNYLRLDTHPIFESI
EILTRETKIIPADVAENLMPSSLKEDSEKCLLKLVEALKQAKQLMIKKEEESALSEAKMKX
Predicted Coding Sequence 
XXTTTTTTTTTAGCTGTCATAACCAATTACCTTGACGAGAAGCAGAAATTGCTTTGCGGCTTCTCTGTGCCTGTTTATAAAGTGAACACA
AATCAAGGGAATTTCAAAACATCTTTAACAATGATCAGAGCAATGGGATTGCTGCAAAGTTGGGGTGGATTCGGGACGAGCATTGCTAGT
TTCATATTCCTGCGGGATATGATCCGTCGATACTGTCCCCCTGAGCTTATCCGAGCTTTCGATAAGTGGACACGAAGAATCAGGAGCTTT
TTCTACCCTTATATTCAGATTTCCATCAGTGAATTCATGAGCAACAATCTCAAGCCTCATGATGCCTATGCAGCAGTTGAGGCATATCTC
AGTGTCCACTTAGCAAAAGACGCAAAGAGGCTTAGAGCTGAAACGGTAACTGGAGGTAGCAAGTTGGTGCTAAGCATGGATGAACATGAG
AAAGTTACTGACGAGTTTTGTGGAGTAAAAGTACAGTGGATTTCTGGCAAACTTGTGCAACGGGAAAGTAAGTACTTGCCAGAACTGGAA
AGAAAATATTACAAGCTTATGTTCCACAAGAAATATCGTGACATGGTAACCGATATTTACTTGGAGCAAGTGATCAAGGCAGGGAAAGAG
ATTCAGATGAGAAACAGGAAGAGAAAGCTCTACACTAATAATGGCCACAGCAAGACCACATGGAGCCATATCGTATTTGAGCATCCTGCA
ACATTTGGTAGCCTGGCAATGGAAGCAGCGAAGAAGCAAGAGATTATGGATGATCTCCTCTTGTTTAGAGATAGCAAAGGATTTCTATGC
AAGGATTGGCAAGGCGTGAAAGCXGTGGTTATCTACTATATAGTCCCGCCGGGTACTGGGAAGTCTACTATGATTGCTGCAATGGCAAAT
TATTGGATTTATGACGTCTGTGATCTTGAATTGACATCTGTGAGGGACAACACAGAATTGAGAAGGCTCTTGGCTGAAACAACAAGTAAG
TCTATTATAGTGATAGAAGATATTGACTGCTCACTTGATCTAACAGGTCAAAGGAAGAAGAAACCTCCAGAAGAGAAGATTGAAAAGACA
AAGAAAGAAGTTTCTCGCAAGGACACCGAAGAGAGTGGAAGTAGAGTCACTCTCTCTGGGCTTCTGAACTTCATTGACGGTCTTTGGTCT
GCATGCAGTGGAGAACGTATAATTGTCTTTACTACAAATTATGTAGATAAGTTGGATCCAGCTCTTACAAGAAGGGGAAGAATGGATAAG
CACATCGAGCTCTCATACTGTAGTTTTGATGGATTCAAGGTGCTTGCAAAGAATTACCTGCGCTTGGACACACATCCCATATTTGAATCA
ATTGAAATTCTAACGAGGGAGACAAAGATTATACCTGCCGATGTTGCAGAGAACCTGATGCCCAGCTCCCTGAAAGAAGACTCAGAGAAA
TGCCTTCTGAAGCTGGTTGAAGCTCTCAAACAGGCAAAACAACTGATGATAAAGAAAGAAGAGGAATCCGCACTGTCTGAAGCTAAAATG
AAACXX\
Edits in Original Sequence 
(5')XXTTTTTTTTTaAGCTGTCATAACCAATTACCTTGACGAGAAGCAGAAATTGCTTTGCGGCTTCTCTGTGCCTGTTaTATAAAGTG
AACACAAATCtAAGGGAATTTCAAAACATCTTTAACAATGATCAGAGCAATGGGATTGCTGCAAAGTTGGGGTGGATTCGGGACGAGCAT
TGCTAGTTTCATATTCCTGCGGGATATGATCCGTCGATACTGTCCCCCTGAGCTTATCCGAGCTTTCGATAAGTGGACACGAAGAATCAG
GAGCTTTTTCTACCCTTATATTCAGATTTCCATCAGTGAATTCATGAGCAACAATCTCAAGCCTCATGATGCCTATGCAGCAGTTGAGGC
ATATCTCAGTGTCCACTTAGCAAAAGACGCAAAGAGGCTTAGAGCTGAAACGGTAACTGGAGGTAGCAAGTTGGTGCTAAGCATGGATGA
ACATGAGAAAGTTACTGACGAGTTTTGTGGAGTAAAAGTACAGTGGATTTCTGGCAAACTTGTGCAACGGGAAAGTAAGTACTTGCCAGA
ACTGGAAAGAAAATATTACAAGCTTATGTTCCACAAGAAATATCGTGACATGGTAACCGATATTTACTTGGAGCAAGTGATCAAGGCAGG
GAAAGAGATTCAGATGAGAAACAGGAAGAGAAAGCTCTACACTAATAATGGCCACAGCAAGACCACATGGAGCCATATCGTATTTGAGCA
TCCTGCAACATTTGGTAGCCTGGCAATGGAAGCAGCGAAGAAGCAAGAGATTATGGATGATCTCCTCTTGTTTAGAGATAGCAAAGGATT
TCTATGCAAGGATTGGCAAGGCGTGAAAGCXGTGGTTATCTACTATATAGTCCCGCCGGGTACTGGGAAGTCTACTATGATTGCTGCAAT
GGCAAAtTTATTGGATTTATGACGTCTGTGATCTTGAATTGACATCTGTGAGGGACAACACAGAATTGAGAAGGCTCTTGGCTGAAACAA
CAAGTAAGTCTATTATAGTGATAGAAGATATTGACTGCTCACTTGATCTAACAGGTCAAAGGAAGAAGAAACCTCCAGAAGAGAAGATTG
AAAAGACAAAGAAAGAAGTTTCTCGCAAGGACACCGAAGAGAGTGGAAGTAGAGTCACTCTCTCTGGGCTTCTGAACTTCATTGACGGTC
TTTGGTCTGCATGCAGTGGAGAACGTATAATTGTCTTTACTACAAATTATGTAGATAAGTTGGATCCAGCTCTTACAAGAAGGGGAAGAA
TGGATAAGCACATCGAGCTCTCATACTGTAGTTTTGATGGATTCAAGGTGCTTGCAAAGAATTACCTGCGCTTGGACACACATCCCATAT
TTGAATCAATTGAAATTCTAACGAGGGAGACAAAGATTATACCTGCCGATGTTGCAGAGAACCTGATGCCCAGCTCCCTGAAAGAAGACT
CAGAGAAATGCCTTCTGAAGCTGGTTGAAGCTCTCAAACAGGCAAAACAACTGATGATAAAGAAAGAAGAGGAATCCGCACTGTCTGAAG
CTAAAATGAAACXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan