Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U275828

Score 
689
Direction 
Forward
Predicted Peptide Sequence 
SAGXVRYNIVSGVASALHYLHNEYEQKVVHRDLKANNIMLDSNFNARLGDFGLARAIDNEKTSYADEAEGVLGTMGYIAPECFHTGKATQ
HSDVYAFGAVLLELICGQRPGTKVNGFQLFLDWVWFLHRDGRILEAVDKRLEDQYVVEEAERLLLLALACSHPIANERPKTQTIVQVISG
SVPAPQVPPFKPSFVWPSMVPIDIDSSSIVDTISITTPQYSSENNSIXISKQVEIAIA
Predicted Coding Sequence 
XXCTCAGCTGGAGXTGTGAGGTACAACATTGTATCGGGAGTTGCGTCAGCTCTGCACTATCTTCACAACGAATACGAGCAGAAGGTAGTC
CATCGTGATCTCAAGGCAAACAACATCATGCTCGACTCAAACTTCAATGCACGTTTAGGTGATTTTGGATTAGCACGAGCAATTGACAAC
GAAAAGACCTCATATGCTGATGAAGCTGAAGGTGTACTTGGCACGATGGGGTACATCGCGCCAGAATGCTTCCACACAGGAAAAGCAACT
CAACATTCTGATGTCTATGCATTCGGAGCTGTGTTGTTGGAGCTAATATGTGGCCAAAGGCCTGGAACTAAAGTTAATGGCTTTCAACTC
TTTCTTGATTGGGTTTGGTTCTTGCATCGCGATGGGAGAATCCTTGAAGCTGTTGACAAGAGGCTCGAGGATCAATACGTGGTTGAAGAA
GCAGAGAGATTGTTACTACTTGCTCTGGCTTGCTCCCATCCAATTGCCAATGAAAGGCCTAAAACACAAACAATAGTTCAAGTCATATCA
GGATCAGTACCAGCACCACAAGTACCACCATTCAAACCATCATTTGTATGGCCTTCTATGGTTCCAATTGACATAGATTCATCGAGCATC
GTCGATACAATATCCATCACAACTCCTCAGTACAGTTCAGAGAACAACAGTATTGAXATATCAAAGCAAGTAGAGATAGCAATAGCTTGA
\
Edits in Original Sequence 
(5')XXCTCAGCTGGAGXTGTGAGGTACAACATTGTATCGGGAGTTGCGTCAGCTCTGCACTATCTTCACAACGAATACGAGCAGAAGGT
AGTCCATCGTGATCTCAAGGCAAACAACATCATGCTCGACTCAAACTTCAATGCACGTTTAGGTGATTTTGGATTAGCACGAGCAATTGA
CAACGAAAAGACCTCATATGCTGATGAAGCTGAAGGTGTACTTGGCACGATGGGGTACATCGCGCCAGAATGCTTCCACACAGGAAAAGC
AACTCAACATTCTGATGTCTATGCATTCGGAGCTGTGTTGTTGGAGCTAATATGTGGCCAAAGGCCTGGAACTAAAGTTAATGGCTTTCA
ACTCTTTCTTGATTGGGTTTGGTTCTTGCATCGCGATGGGAGAATCCTTGAAGCTGTTGACAAGAGGCTCGAGGATCAATACGTGGTTGA
AGAAGCAGAGAGATTGTTACTACTTGCTCTGGCTTGCTCCCATCCAATTGCCAATGAAAGGCCTAAAACACAAACAATAGTTCAAGTCAT
ATCAGGATCAGTACCAGCACCACAAGTACCACCATTCAAACCATCATTTGTATGGCCTTCTATGGTTCCAATTGACATAGATTCATCGAG
CATCGTCGATACAATATCCATCACAACTCCTCAGTACAGTTCAGAGAACAACAGTATTGAXATATCAAAGCAAGTAGAGATAGCAATAGC
TTGA\(3')TTTAGGCCACTAAGATATTTTTTTTGCTTATTGTGTAATGACAAGAATAGCAGCCCACGTATATATTTCTCAGCCTTTTAT
GTTAAATTCCATCCTATACATTGTTCCTTCTACAGTTTGACTGTTTGGTTTGTTGTATTAAAAATGACATGTATTGCATAATTTCTAAAA
AGAAGTTGTTCGTTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan