ESTScan Details for Unigene SGN-U275846

Score 
559
Direction 
Forward
Predicted Peptide Sequence 
QKHCHASFPEAVEESLPVAGDIHAKIPCLXHALNNRLWSDLFPTMVVEWLMVASVVVVSLEIVHXEEGVKERGMVDGGNKDDALRAKEIA
ERKFSDKDFLGAKKFALKAQNLNPGLEGISQMLATLGVHIAAENKVNGEGNFYGILGVSPKADDEAIRKQYRKLALMLHPDKNKSIGAEA
AFKHVSEAWSLLSDKNKKTVYDNRNAECLAAENPGRKCGFFSQSTQNGFHKFAKNAAX
Predicted Coding Sequence 
CAAAAGCATTGTCACGCGTCTTTCCCGGAGGCAGTAGAAGAGTCCTTGCCGGTCGCCGGAGATATTCACGCCAAAATTCCTTGCCTTXTT
CATGCTCTAAACAATCGTCTGTGGTCAGATCTCTTCCCAACCATGGTTGTTGAATGGCTGATGGTTGCTTCTGTTGTTGTTGTTTCACTT
GAAATAGTACATGXAGAAGAAGGGGTAAAAGAGAGGGGTATGGTAGATGGAGGCAATAAAGATGATGCTTTAAGGGCTAAAGAAATTGCT
GAGAGAAAATTCTCGGATAAGGATTTTTTGGGCGCGAAAAAGTTTGCTTTAAAGGCCCAGAATCTGAATCCTGGACTTGAAGGTATTAGT
CAAATGTTGGCAACACTCGGTGTTCATATTGCTGCTGAGAACAAAGTTAATGGTGAAGGAAATTTTTATGGAATCCTTGGTGTTAGTCCA
AAAGCTGATGATGAGGCTATAAGGAAACAGTATAGGAAACTGGCCCTCATGCTTCATCCTGATAAGAACAAGTCCATAGGGGCCGAAGCT
GCGTTTAAGCATGTTTCAGAAGCATGGAGCTTGTTGTCTGATAAAAACAAGAAAACAGTGTATGACAATAGAAATGCXGAGTGTCTTGCA
GCAGAGAATCCGGGCAGAAAATGTGGATTCTTCTCACAATCTACACAGAATGGTTTTCACAAATTTGCAAAGAATGCTGCTTXX\
Edits in Original Sequence 
(5')CAAAAGCATTGTCACGCGTCTTTCCCGGAGGCAGTAGAAGAGTCCTTGCCGGTCGCCGGAGATATTCACGCCAAAATTCCTTGCCT
TXTTCATGCTCTAAACAATCGTCTGTGGTCAGATCTCTTCCCAACCATGGTTaGTTGAATGGCTGATGGTTGCTTCTGTTGTTGTTGTTT
CACTgTGAAATAGTACATGXAGAAGAAGGGGTAAAAGAGAGGGGTATGGTAGATGGAGtGCAATAAAGATGATGCTTTAAGGGCTAAAGA
AATTGCTGAGAGAAAATTCTCGGATAAGGATTTTTTGGGCGCGAAAAAGTTTGCTTTAAAGGCCCAGAATCTGAATCCTGGACTTGAAGG
TATTAGTCAAATGTTGGCAACACTCGGTGTTCATATTGCTGCTGAGAACAAAGTTAATGGTGAAGGAAATTTTTATGGAATCCTTGGTGT
TAGTCCAAAAGCTGATGATGAGGCTATAAGGAAACAGTATAGGAAACTGGCCCTCATGCTTCATCCTGATAAGAACAAGTCCATAGGGGC
CGAAGCTGCGTTTAAGCATGTTTCAGAAGCATGGAGCTTGTTGTCTGATAAAAACAAGAAAACAGTGTATGACAATAGAAATGCXGAGTG
TCTTGCAGCAGAGAATCCGGGCAGAAAATGTGGATTCTTCTCACAATCTACACAGAATGGTTTTCACAAATTTGCAAAGAATGCTGCTTX
X\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan