ESTScan Details for Unigene SGN-U275868

Score 
537
Direction 
Reverse
Predicted Peptide Sequence 
GPPFALIFAASSVLDFEMKYRKDATLDWIFDLSSEITGPDSWFDYVLISVSGEDSVEDXNMENGHESLSNGKPADPGLQIIRHPSYQSSC
GKLSLSWLDIRVFYIRVSNFMVDDSTPEYLTLNHIPLSPDTLLEVNGTRCSMYSEGASCLLRRDRVDKKSEEATFVSTDSIRLTGSVKFE
VFDKDDLVLSGFLEMSNSNGFVGESKSSSRRWNMDCESVMNAGTGFLKGKQIMDSESLSPTIEVFITGCFSGTPIILTKSLQLNHRKKHN
RKGMLHSIPEHETDEQQKDVSSELDLQVTEYRKYELESEEDYNMYWRQTEYMDGEDGELSWFNAGVRVGVGMALAFAVGVGIGVGLLSAP
PDYYAELQKACVIM
Predicted Coding Sequence 
XCGGGCCCCCCCTTTGCTTTGATTTTTGCXGCCAGTTCAGTTCTTGATTTTGAGATGAAATATAGAAAAGATGCAACTTTGGATTGGATT
TTTGATTTGTCATCTGAAATTACTGGTCCCGATTCATGGTTCGATTATGTCCTTATATCGGTGTCTGGTGAAGATTCTGTTGAGGATXTA
AACATGGAGAATGGTCATGAATCACTCAGCAATGGAAAACCAGCTGATCCTGGTCTCCAAATTATTAGGCACCCCTCTTACCAATCATCT
TGTGGTAAATTATCGTTATCTTGGTTAGATATAAGAGTTTTCTATATTAGAGTCAGCAATTTTATGGTAGATGATTCCACCCCGGAATAT
CTTACTCTCAACCACATTCCTCTAAGTCCCGATACATTGCTTGAAGTTAATGGAACAAGATGTTCCATGTATTCAGAAGGAGCATCTTGT
CTCCTTCGAAGGGATCGGGTTGATAAGAAATCCGAAGAAGCTACATTTGTGAGCACGGATAGTATAAGGTTGACAGGAAGTGTGAAATTT
GAGGTTTTCGATAAAGATGATCTTGTGCTCTCGGGGTTTTTAGAGATGTCGAATAGTAATGGTTTTGTTGGGGAGTCTAAAAGCAGTAGC
AGGAGATGGAACATGGATTGTGAATCGGTGATGAATGCTGGCACTGGTTTCCTGAAGGGTAAACAAATTATGGATTCTGAATCATTATCA
CCAACAATTGAAGTCTTTATTACTGGTTGCTTCTCCGGGACGCCTATCATCTTGACCAAGAGTTTGCAGCTCAATCATCGGAAGAAGCAC
AACAGGAAGGGTATGTTACACTCAATCCCGGAGCATGAAACAGATGAACAGCAGAAAGATGTCTCATCTGAACTTGATCTGCAGGTTACA
GAGTATAGAAAGTATGAACTAGAAAGCGAAGAAGACTACAACATGTATTGGAGACAAACGGAATATATGGATGGTGAAGATGGGGAACTA
TCCTGGTTCAATGCTGGGGTCCGTGTTGGTGTAGGGATGGCCTTGGCATTTGCXGTAGGAGTTGGAATAGGAGTTGGCCTGTTGTCCGCA
CCACCAGACTACTACGCGGAACTTCAGAAGGCTTGTGTGATTATGTAG\
Edits in Original Sequence 
(5')XCGGGCCCCCCCTTTGCTTTGATTTTTGCXGCCAGTTCAGTTCTTGATTTTGAGATGAAATATAGAAAAGATGCAACTTTGGATTG
GATTTTTGATTTGTCATCTGAAATTACTGGTCCCGATTCATGGTTCGATTATGTCCTTATATCGGTGTCTGGTGAAgGATTCTGTTGAGG
ATXTAAACATGGAGAATGGTCATGAATCACTCAGCAATGGAAAACCAGCTGATCCTGGTCTCCAAATTATTAGGCACCCCTCTTACCAAT
CATCTTGTGGTAAATTATCGTTATCTTGGTTAGATATAAGAGTTTTCTATATTAGAGTCAGCAATTTTATGGTAGATGATTCCACCCCGG
AATATCTTACTCTCAACCACATTCCTCTAAGTCCCGATACATTGCTTGAAGTTAATGGAACAAGATGTTCCATGTATTCAGAAGGAGCAT
CTTGTCTCCTTCGAAGGGATCGGGTTGATAAGAAATCCGAAGAAGCTACATTTGTGAGCACGGATAGTATAAGGTTGACAGGAAGTGTGA
AATTTGAGGTTTTCGATAAAGATGATCTTGTGCTCTCGGGGTTTTTAGAGATGTCGAATAGTAATGGTTTTGTTGGGGAGTCTAAAAGCA
GTAGCAGGAGATGGAACATGGATTGTGAATCGGTGATGAATGCTGGCACTGGTTTCCTGAAGGGTAAACAAATTATGGATTCTGAATCAT
TATCACCAACAATTGAAGTCTTTATTACTGGTTGCTTCTCCGGGACGCCTATCATCTTGACCAAGAGTTTGCAGCTCAATCATCGGAAGA
AGCACAACAGGAAGGGTATGTTACACTCAATCCCGGAGCATGAAACAGATGAACAGCAGAAAGATGTCTCATCTGAACTTGATCTGCAGG
TTACAGAGTATAGAAAGTATGAACTAGAAAGCGAAGAAGACTACAACATGTATTGGAGACAAACGGAATATATGGATGGTGAAGATGGGG
AACTATCCTGGTTCAATGCTGGGGTCCGTGTTGGTGTAGGGATcGGCCTTGGCATTTGCXGTAGGAGTTGGAATAGGAGTTGGCCTGTTa
GTCCGCACCtACCAGACTACTACGCGGAACTTCAGAAGGCTTGTGTGATTATGTAG\(3')CGGTAGCTGCATTTGTTTTTGCATAGACC
AAACTGCTAACAACAGATATATGCTTGTCTTGAGAGTGTGAATTCTGCTCATTAGACAGTTTCACTGTAGCTAACCATCATACATTTTCG
TGTTAACTTACTTCCTGCTACCTTTTCGTCTTCCCTTGCCCCATCCCCGTCCCCGTGTTAAGTCTCTTTGTACCCCCTTCTTGTGTTGGA
TTTAGGTGTGCAACTTCTTACTGTTGTAGATGTTCCATTCTGTTGCAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan