ESTScan Details for Unigene SGN-U275896

Score 
468
Direction 
Forward
Predicted Peptide Sequence 
KNHPLLSIAIPLNLGIRLPISSSAMAAGXGNVFLDENYNLVPEYPSWNRLLHHFNSSGLVDQEKVKEFVAEQVQESEEGISTDCIVSGAF
MKIVGKEKSFVMVKDWEQSQQVGDPHIEFTSNYKHKRELGKECHYXESKDPMEVQNYLVEKWKTREVMKARLERAKMLREYHGTIFPYSE
FKGSQVAVPRGKSKEEQKKGWVLVRRDHPSRIGGAYALDPPCLQKRVAFLKLALSGFLSCFLDFTMSQTDDNFTSYFGEVPPILDYFDCQ
TYPKNSQESSILSSHRQFNEHYQSHHHNNQLPTDQFVMNRPDVSPTSRHVFVDASTTA
Predicted Coding Sequence 
AAGAACCACCCTCTGCTCTCCATTGCTATCCCATTAAACCTCGGAATACGCCTCCCAATCTCTTCATCGGCAATGGCCGCCGGTXACGGA
AACGTTTTCTTGGATGAGAATTACAATCTTGTCCCTGAGTATCCTTCTTGGAATCGTCTCTTGCATCATTTCAATTCCTCCGGCCTGGTT
GATCAGGAAAAGGTGAAAGAATTTGTTGCTGAGCAAGTTCAAGAATCGGAAGAGGGAATTTCTACGGACTGCATTGTTAGTGGTGCCTTT
ATGAAAATTGTTGGAAAAGAGAAGAGTTTTGTTATGGTTAAGGATTGGGAACAAAGCCAACAAGTAGGAGATCCACACATAGAATTTACA
AGCAATTATAAGCACAAAAGGGAGCTAGGAAAAGAATGTCATTACGAXGAGAGTAAGGACCCGATGGAAGTACAAAATTATCTTGTGGAG
AAATGGAAAACTCGAGAAGTAATGAAAGCTCGTCTTGAACGGGCAAAAATGTTAAGAGAGTATCATGGCACTATTTTCCCATATTCAGAG
TTCAAGGGTTCCCAAGTGGCGGTTCCTAGAGGCAAATCGAAGGAAGAGCAAAAGAAAGGTTGGGTGCTGGTGCGGCGTGACCATCCTTCT
CGAATAGGTGGGGCCTACGCTCTAGATCCTCCCTGCTTGCAGAAACGTGTGGCGTTTTTGAAGTTAGCACTCTCTGGTTTTCTCTCTTGT
TTCCTTGATTTTACAATGTCCCAAACCGATGATAATTTCACAAGTTATTTTGGGGAGGTTCCACCAATTCTTGACTATTTTGACTGCCAA
ACCTACCCAAAAAATTCGCAGGAATCGTCTATACTCAGCAGCCACAGGCAATTCAATGAACACTATCAATCACATCATCACAATAATCAA
TTGCCAACAGATCAGTTTGTGATGAATCGACCTGATGTGTCTCCAACCTCGAGGCATGTGTTTGTTGATGCAAGTACAACGGCTTAA\
Edits in Original Sequence 
(5')AAGAACCACCCTCTGCTCTCCATTGCTATCCCATTAAACCTCGGAATACGCCTCCCAATCTCTTCATCGGCAATGGCCGCCGGTXA
CGGAAACGTTTTCTTGGATGAGAATTACAATCTTGTCCCTGAGTATCCTTCTTGGAATCGTCTCTTGCATCATTTCAATTCCTCCGGCCT
GGTTGATCAGGAAAAGGTGAAAGAATTTGTTGCTGAGCAAGTTCAAGAATCGGAAGAGGGAATTTCTACGGACTGCATTGTTAGTGGTGC
CTTTATGAAAATTGTTGGAAAAGAGcAAGAGTTTTGTTATGGTTAAGGATTGGGAACAAAGCCAACAAGTAGGAGATCCACACATAGAAT
TTACAAGCAATTATAAGCACAAAAGGGAGCTAGGAAAAGAATGTCATTACGAXGAGAGTAtAGGACCCGATGGAAGTACAAAATTATCTT
GTGGAGAAATGGAAAACTCGAGAAGTAATGAAAGCTCGTCTTGAACGGGCAAAAATGTTAAGAGAGTATCATGGCACTATTTTCCCATAT
TCAGAGTTCAAGGGTTCCCAAGTGGCGcGTTCCTAGAGGCAAATCGAAGGAAGAGCAAAAGAAAGGTTGGGTGCTGGTGCGGCGTGACCA
TCCgTTCTCGAATAGGTGGGGCCTACGCTCTAGATCCTCCCTGCTTGCAGAAACGTGTGGtCGTTTTTGAAGTTAGCACTCTCTGGTTTT
CTCTCTTGTTTCCTTGATTTTACAATGTCCCAAACCGATGATAATTTCACAAGTTATTTTGGGGAGGTTCCACCAATTCTTGACTATTTT
GACTGCCAAACCTACCCAAAAAATTCGCAGGAATCGTCTATACTCAGCAGCCACAGGCAATTCAATGAACACTATCAATCACATCATCAC
AATAATCAATTGCCAACAGATCAGTTTGTGATGAATCGACCTGATGTGTCTCCAACCTCGAGGCATGTGTTTGTTGATGCAAGTACAACG
GCTTAA\(3')ATTACGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan