ESTScan Details for Unigene SGN-U275920

Score 
790
Direction 
Forward
Predicted Peptide Sequence 
NHEEAVSGFALSKMLAXVISTSGGKISLFQHDDVQESENFQPPPPAATYIAFHPQDNNIIAIGMDNSTIQIYNVRPGEVKSKLKGHSKRI
TGITFSHLLNVLVSSGAESQLCMEHCWEGNAEGWILAATGVIDAQSDTRAQFHQDQTHFFVVHEAQIAIYXNNKVEMFKALGSAANPNFS
CDSQLIHASFLDATGAYSLQGTSICDASIIPSAYFSPSMSSSNIHPVVAAHLEDPKQYAEVMSDGSVHVSEPLESEGKWGVPPPLENGFA
EGVPATEGKWGVPPPLVNGFAEGVPAAPSVELKALIKHQDNREAIKQTDGLGLVGSYPNFSFRWSKHAVYWSQLKILTW
Predicted Coding Sequence 
XCAAACCATGAGGAAGCTGTCTCCGGCTTTGCTTTGTCCAAAATGCTTGCTXATGTGATATCAACATCTGGTGGAAAGATCTCCTTGTTT
CAACATGATGACGTTCAAGAGAGTGAGAACTTTCAGCCTCCACCTCCAGCAGCAACTTATATTGCCTTCCATCCTCAAGATAACAACATC
ATCGCTATTGGCATGGATAATTCTACCATCCAGATATATAATGTCCGACCTGGTGAAGTTAAAAGCAAGCTTAAAGGGCACTCTAAAAGG
ATAACTGGCATCACCTTCTCTCATTTGCTCAATGTGCTAGTTTCCTCAGGAGCTGAATCTCAGCTGTGTATGGAGCACTGTTGGGAGGGA
AATGCAGAGGGCTGGATCCTTGCAGCTACGGGGGTGATCGATGCTCAATCAGATACCAGAGCACAGTTTCATCAGGATCAAACTCATTTC
TTTGTTGTGCATGAGGCACAGATTGCAATATATGAXAACAACAAAGTTGAAATGTTTAAAGCATTGGGTTCCGCXGCTAACCCCAATTTC
TCATGTGATAGCCAGCTGATACATGCCAGTTTCTTGGATGCAACTGGTGCATATTCACTGCAGGGCACCTCCATATGCGATGCCAGTATT
ATTCCTTCAGCTTATTTTTCACCCAGTATGAGCAGTTCAAATATCCACCCAGTTGTTGCAGCACATCTAGAAGATCCAAAGCAGTATGCT
GAGGTXATGTCAGATGGTAGTGTTCATGTTTCCGAACCACTTGAATCTGAAGGCAAATGGGGCGTCCCTCCACCACTTGAAAATGGTTTT
GCAGAAGGTGTGCCAGCAACTGAAGGCAAATGGGGCGTCCCGCCACCACTTGTAAATGGTTTTGCAGAAGGTGTGCCAGCTGCTCCATCT
GTGGAGCTTAAAGCTTTGATCAAGCACCAAGATAACAGAGAAGCCATTAAGCAAACAGACGGTCTTGGTCTTGTTGGATCTTACCCAAAT
TTCAGTTTCAGATGGTCAAAACATGCAGTGTACTGGTCACAGCTTAAAATTTTGACTTGG\
Edits in Original Sequence 
(5')XCAAACCATGAGGAAGCTGTCTCCGGCTTTGCTTTGTCCAAAATGCTTGCTXATGTGATATCAACATCTGGTGGAAAGATCTCCTT
GTTTCAACATGATGACGTTCAAGAGAGTGAGAACTTTCAtGCCTCCACCTCCAGCAGCAACTTATATTGCCTTCCATCCTCAAGATAACA
ACATCATCGCTATTGGCATGGATAATTCTACCATCCAGATATATAATGTCCGACCTGGaTGAAGTTAAAAGCAAGCTTAAAGGGCACTCT
AAAAGGATAACTGGCATCACCTTCTCTCATTTGCTCAATGTGCTAGTTTCCTCAGGAGCTGAATCTCAGCTGTGTATGGAGCACTGTTGG
GAGGGAAATGCAGAGGGCTGGATCCTTGCAGCTACGGGGGTGATCGATaGCTCAATCAGATACCAGAGCACAGTTTCATCAGGATCAAAC
TCATTTCTTTGTTGTGCATGAGGCACAGATTGCAATATATGAXAACAACAAAGTTGAAATGTTTAAAGCATTGGGTTCCGCXGCTAACCC
CAATTTCTCATGTGATAGCCAGCTGATACATGCCAGTTTCTTGGATGCAACTGtGTGCATATTCACTGCAGGGCACCTCCATATGCGATG
CCAGTATTATTCCTTCAGCTTATTTTTCACCCAGTATGAGCAGTTCAAATATCCACCCAGTTGTTGCAGCACATCTAGAAGATCCAAAGC
AGTATGCaTGAGGTXATGTCAGATGGTAGTGTTCATGTTTCCGAACCACTTGAATCTGAAGGCAAATGGGGCGTCCCTCCACCACTTGAA
AATGGTTTTGCAGAAGGTGTGCCAGCAAtCTGAAGGCAAATGGGGCGTCCCGCCACCACTTGTAAATGGTTTTGCAGAAGGTGTGCCAGC
TGCTCCATCTaGTGGAGCTTAAAGCTTTGATCAAGCACCAAGATAACAGAGAAGCCATTAAGCAAACAGACGGTCTTGGTCTTGTTGGAT
CTTACCCAAATTTCAGTTTCAGATGGTCAAAACATGCAGTGTACTGGTCACAGCTTAAAATTTTGACTTGG\(3')TATTTACACCATGT
AATCTAATGAAAGAAGTTGTATTTCTATTTATGAATATACAAGGTATTTATACAATTATAGGGAATCCTATAAAAGGAAATCAATCAAAG
CAAATAAAAGAAAATATTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan