ESTScan Details for Unigene SGN-U275934

Score 
247
Direction 
Forward
Predicted Peptide Sequence 
EYPFGQNYDACPGINENLNPNTXAEIPFSLYSKDFISNKHRQXLRKFRLXIKAAIMAHLLSTTCSLDVSSSNKLHFKSINQCSTPIPTSF
NMGISFSPLKKLSLQSKRSAKYVIRASAVSMSQEARTQNDSSSQQTTDGASTRKKVMVIGGDGYCGWATALHLSNKGYEVAIVDNLIRRL
FDDQLGLDSLTPISSIHNRIRRWKSLTGKDIQLFVGDICEFEFLAEAFKSFEPDSVVHFGEQRSAPYSMIDRS
Predicted Coding Sequence 
XXAGAATATCCGTTTGGGCAAAACTATGATGCTTGCCCTGGGATAAATGAAAATCTTAACCCCAATACTXTAGCCGAGATACCTTTCTCA
CTCTATTCTAAGGATTTTATCTCTAACAAGCATCGCCAGGXTTTAAGAAAGTTTAGGCTCATXATCAAGGCGGCTATCATGGCACATTTA
CTTTCTACTACGTGTTCTTTAGATGTCTCTTCCAGCAACAAGCTGCATTTCAAGTCAATTAACCAATGCTCTACTCCTATTCCAACATCT
TTTAATATGGGAATTTCTTTCTCACCCTTGAAAAAGCTAAGTTTGCAAAGCAAAAGGTCTGCAAAATATGTGATCAGAGCTTCAGCTGTT
TCCATGAGCCAAGAAGCCAGAACCCAGAATGACTCTAGTTCTCAACAGACCACTGATGGAGCCTCCACTAGGAAGAAGGTCATGGTCATT
GGTGGGGATGGCTATTGTGGCTGGGCTACTGCTCTCCACCTATCCAACAAGGGATATGAAGTTGCCATTGTTGACAACCTTATCCGTCGC
CTATTTGACGACCAGCTTGGTCTAGATTCTCTAACACCCATCTCATCTATCCATAACCGCATAAGGCGTTGGAAATCTCTCACAGGAAAA
GACATTCAACTGTTTGTTGGTGATATATGTGAGTTTGAGTTCTTGGCAGAAGCCTTCAAATCCTTTGAACCTGATTCTGTAGTCCATTTT
GGAGAGCAGAGGTCTGCCCCTTATTCTATGATTGATAGGTCX\
Edits in Original Sequence 
(5')XXAGAATATCCGTTTGGGCAAAACTATGATGCTTGCCCTGGGATAAATGAAAATCTTAACCCCAATACTXTAGCCGAGATACCTTT
CTCACTCTATTCTAAGGATTTTATCTCTAACAAGCATCGCCAGGXTTTAAGAAAGTTTAGGCTCATXATCAAGGCGGCTATCATGGCACA
TTTACTTTCTACTACGTGTTCTTTAGATGTCTCTTCCAGCAACAAGCTGCATTTCAAGTCAATTAACCAATGCTCTACTCCTATTCCAAC
ATCTTTTAATATGGGAATTTCTTTCTCACCCTTGAAAAAGCTAAGTTTGCAAAGCAAAAGGTCTGCAAAATATGTGATCAGAGCTTCAGC
TGTTTCCATGAGCCAAGAAGCCAGAACCCAGAATGACTCTAGTTCTCAACAGACCACTGATGGAGCCTCCACTAGGAAGAAGGTCATGGT
CATTGGTGGGGATGGCTATTGTGGCTGGGCTACTGCTCTCCACCTATCCAACAAGGGATATGAAGTTGCCATTGTTGACAACCTTATCCG
TCGCCTATTTGACGACCAGCTTGGTCTAGATTCTCTAACACCCATCTCATCTATCCATAACCGCATAAGGCGTTGGAAATCTCTCACAGG
AAAAGACATTCAACTGTTTGTTGGTGATATATGTGAGTTTGAGTTCTTGGCAGAAGCCTTCAAATCCTTTGAACCTGATTCTGTAGTCCA
TTTTGGAGAGCAGAGGTCTGCCCCTTATTCTATGATTGATAGGTCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan