ESTScan Details for Unigene SGN-U275943

Score 
834
Direction 
Forward
Predicted Peptide Sequence 
MNPKGLIYSFVARGTVVLAEHTPYSGNFSTIAVQCLQKLPSNSSKYTYSCDGHTFNFLLDSGFVFLVVADEPTGRSVPFVFLERVKDDFK
KRYGSSIKNDGDPHPLADDDEEDDDLFGDRFSIAYNLDREFGPKLKEHMEYCMNHPDEMSKLSKLKAQITEVKGIMMDNIEKVLDRGEKI
ELLVDKTENLQFQAXQLPEARKAASSQDVVSEPSNETNGGGAVVIFIIIIWLFACGGFKC
Predicted Coding Sequence 
ATGAATCCAAAAGGTTTGATTTATAGCTTTGTTGCGAGAGGGACTGTTGTTCTAGCTGAGCATACACCTTATTCAGGGAACTTTAGTACT
ATTGCTGTTCAGTGCTTGCAGAAGCTCCCTTCAAATAGTAGCAAGTATACATACTCATGCGATGGTCACACCTTCAACTTCCTTCTAGAT
AGTGGCTTTGTCTTCCTAGTTGTTGCTGATGAACCAACAGGAAGAAGTGTACCGTTTGTGTTTCTTGAAAGGGTTAAGGATGATTTCAAG
AAACGCTATGGTTCAAGTATCAAAAATGATGGCGATCCACATCCTCTTGCTGATGATGATGAAGAAGATGATGATCTATTTGGGGATCGT
TTTAGCATTGCGTACAATCTTGACAGAGAATTTGGGCCAAAACTTAAAGAGCACATGGAATACTGTATGAACCATCCTGATGAAATGAGC
AAGCTCTCTAAATTGAAGGCTCAAATCACAGAGGTCAAAGGAATAATGATGGACAATATTGAGAAGGTTTTGGATCGGGGTGAGAAGATT
GAACTGCTAGTGGATAAAACGGAGAACCTTCAGTTCCAGGCTGAXCAGCTTCCAGAGGCAAGGAAGGCAGCTTCGTCGCAAGATGTGGTT
TCAGAACCTTCAAATGAAACTAATGGTGGAGGTGCTGTTGTAATTTTCATTATCATCATTTGGCTTTTCGCTTGTGGAGGTTTCAAATGT
TGA\
Edits in Original Sequence 
CTCAACTCCTCGACTCCATCGCTGTTAAAGACAAAGACCCCTCCCCCCCACGCCCGCACCCCACCCTCTTTCTGCGAAATCTAAAGCTCC
ATTTTCAGTCGTGTACACTAAGTAATCGCCATTTTTCCAATCTCAGGCATAAAGTTGGAGCTGTGATTGAAA
(5')ATGAATCCAAAAGG
TTTGATTTATAGCTTTGTTGCGAGAGGGACTGTTGTTCTAGCTGAGCATACACCTTATTCAGGGAACTTTAGTACTATTGCTGTTCAGTG
CTTGCAGAAGCTCCCTTCAAATAGTAGCAAGTATACATACTCATGCGATGGTCACACCTTCAACTTCCTTCTAGATAGTGGCTTTGTCTT
CCTAGTTGTTGCTGATGAACCAACAGGAAGAAGTGTACCGTTTGTGTTTCTTGAAAGGGTTAAGGATGATTTCAAGAAACGCTATGGTTC
AAGTATCAAAAATGATGGCGATCCACATCCTCTTGCTGATGATGATGAAGAAGATGATGATCTATTTGGGGATCGTTTTAGCATTGCGTA
CAATCTTGACAGAGAATTTGGGCCAAAACTTAAAGAGCACATGGAATACTGTATGAACCATCCTGATGAAATGAGCAAGCTCTCTAAATT
GAAGGCTCAAATCACAGAGGTCAAAGGAATAATGATGGACAATATTGAGAAGGTTTTGGATCGGGGTGAGAAGATTGAACTGCTAGTGGA
TAAAACGGAGAACCTTCAGTTCCAGGCTGAXCAGCTTCCAGAGGCAAGGAAGGCAGCTTCGTCGCAAGATGTGGTTTCAGAACCTTCAAA
TGAAACTAATGGTcGGAGGTGCTGTTGTAATTTTCATTATCATCATTTGGCTTTTCGCTTGTGGAGGTTTCAAATGTTGA\(3')AAAGG
GATTTCGACGTAATCATTTGGGAATAGTACACTTTTATCTCTCATTTCTGTAGTGTACAAAACCTTTCTTGTAAATGTGAGACAATGCTG
TGGACGCTTTGTTTTGGTGACTTAATACTATGGTATGGTACCTATTAGTGTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan