ESTScan Details for Unigene SGN-U275985

Score 
198
Direction 
Forward
Predicted Peptide Sequence 
DGAAGMSGGQVTHPANEGDGIFRTGLKPWQKLKPSIEILCCNQVLSPDMSLATVRAYIWKKPEDLXPQLPGVDEQGIGFYXVRSRELEVI
ELLLKNNGRLSIQMAAAAVS
Predicted Coding Sequence 
GATGGAGCTGCTGGAATGTCTGGTGGACAGGTGACACACCCAGCTAATGAGGGAGATGGCATATTTCGGACTGGGCTGAAGCCTTGGCAA
AAGCTTAAACCATCCATAGAAATCCTGTGCTGTAACCAGGTTTTATCCCCTGATATGAGCTTAGCGACTGTCCGTGCGTATATATGGAAG
AAACCTGAAGACCTTGXTCCTCAACTACCGGGTGTTGACGAGCAAGGGATAGGATTCTATXTTGTCAGGTCCAGAGAGCTTGAGGTGATT
GAGCTGCTCCTCAAAAATAATGGAAGGCTTAGCATTCAAATGGCTGCTGCTGCTGTGTCCTGA\
Edits in Original Sequence 
(5')GATGGAGCTGCTGGAATGTCTGGTGGACAGGTGACACACCCAGCTAATGAGGGAGATGGCATATTTCGGACTGGGCTGAAGCCTTG
GCAAAAGCTTAAACCATCCATAGAAATCCTGTGCTGTAACCAGGTTTTATCCCCTGATATGAGCTTAGCGACTGTCCGTGCGTATATATG
GAAGAAACCTGAAGACCTTGXTCCTCAACTACCGGGTGTTGACGAGCAAGGGATAGGATTCTATXTTGTCAGGTCCAGAGtAGCTTGAGG
TGATTGAGCTGCTCCTCAAAAATAAtTGGAAGGCTTAGCATTCAAATGGCTGCtTGCTGCTGTGTCCTGA\(3')GTAATTGCTTCCTTG
TAGATCTGGGATCCAAGTGGTTGGATTAATTAGGAAAATTTACACATTTGGACCATTTTGCTGTTTGCACGTCGAAAGGTGTTGATTATT
GAGTTTTGGTTTTTTGGTGCATTTAGAAGAAAATAGAAAGAAAGTTTGCATTAGCTAAAGAAAGGATTTTTGGTTTTGAGGGGACATGAG
ACTGAATGTTTCAAGAGAAAGAGCTCGTGATGATGTCGGGAGCCTGTAGATTTATATATAACTCTATATGCAAAGGCAGGGGTTTGGATG
TCTCGATATAGTCTTTCAAGAACCACACTGTTGGGCAGGTGAATAATATCTCCAGAACAAAAAATTACCTTTTCTGGTCAAACTAATTTA
TATGTTTACCTTCTTTCTGGTATAATTTAATCTGTAAATCTTCTTTGTTATTAGTATTCCTCAAGTGTAGTGAGGGAAGATTTGGTGATA
GGCCATTTATAACGCCAAGCAGATTGTTCTTATATAGTTCTTACCGACTGTACGATGATGTTGCTCCGAATGGTGAAGTTTTGTGCTCAT
GTATTTGGAACTATTTCTTTTAAGCATTCAAGTTTTGAATGAAACATTCTGGAGATAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan