Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U276146

Score 
438
Direction 
Reverse
Predicted Peptide Sequence 
MEDXLLIRQRIEFPGDKLGPSNELGFPSTEQGDVRREPAQPFKLPMIDNHQPNRETAMAAVENNVNNSVKMENELIDLNSRPHRMHGQTS
NNQEQGMDMLGGSNHESVGVVPDDPSKENRRSDQDGAAAIPNFKLDYELELPAPAEFYAMSKF
Predicted Coding Sequence 
ATGGAAGATXATCTCCTTATAAGGCAGAGGATTGAGTTTCCGGGGGATAAATTGGGCCCTTCAAATGAGCTAGGATTTCCATCTACTGAA
CAAGGTGATGTAAGGAGGGAGCCTGCACAGCCCTTTAAGCTCCCTATGATAGACAATCACCAACCAAACAGGGAGACTGCTATGGCAGCA
GTAGAAAATAACGTGAATAATAGCGTGAAAATGGAGAATGAGTTGATTGACCTTAATTCCAGACCTCATAGGATGCATGGTCAAACGTCA
AATAATCAGGAACAAGGAATGGACATGCTTGGTGGTAGCAATCATGAGTCAGTCGGTGTGGTTCCTGATGACCCTTCAAAAGAGAACCGG
AGAAGTGATCAAGATGGAGCTGCTGCCATTCCAAATTTCAAACTTGATTATGAATTGGAGTTGCCGGCCCCAGCTGAGTTCTATGCAATG
TCAAAGTTTTAA\
Edits in Original Sequence 
TTGTGGGTGTTCTTTGTTTTTTGTTAAATCGACAGTATGGTAAGTGAAATCAATGGTCTGAAGTGGATTCTTGAAAAATGAGTAAAGGAA
ATTGAATAGTGAAACTATAGAAACAAATATGAGAACCCTTTGTGATGTTTGTGAAAGTGCAGCCCGCAATACTTTTCTGTGCTGCTGATG
AAGGCGGCTCTCTGCCGTTCTTGTGACAAAAAGGTCCATATGTGCAACAAGCTTGCAAGTCGACATGTAAGAGTTGGGCTAGCTGACCCC
AGTAAAATCCAGCGTTGCGACATATGTGAAAATGCACCTGGTATGTAACTTCATTTCTTCTCTTTCCTTATCCTGTTTCTGTTTGCCAAG
ATGGCAACATTATATGAAGTTTTTGCTTCTTTGCTGGATACATGTATGTAGCTTTCTTTTATTGTGAGATCGATGGAAGTCCCTTTGTTT
GCAATGTGATATGATTGTCCATGTTGGAGGTAAACGAACCC
(5')ATGGAAGATXATCTCCTTATAAGGCAGAGGATTGAGTTTCCGGGG
GATAAATTGGGCCCTTCAAATGAGCTAGGATTTCCATCTACTGAACAAGGTGATGTAAGGAGGGAGCCTGCACAGCCCTTTAAGCTCCCT
ATGATAGACAATCACCAACCAAACAGGGAGACTGCTATGGCAGCAGTAGAAAATAACGTGAATAATAGCGTGAAAATGGAGAATGAGTTG
ATTGACCTTAATTCCAGACCTCATAGGATGCATGGTCAAACGTCAAATAATCAGGAACAAGGAATGGACATGCTTGGTGGTAGCAATCAT
GAGTCAGTCGGTGTGGTTCCTGATgGACCCTTCAAAAGAGAACCGGAGAAGTGATCAAGATGtGAGCTGCTGCCATTCCAAATTTCAAAC
TTGaATTATGAATTGGAGTTGCCGGCCCCAGCTGAGTTCTATGCAATGTCAAAGTTTTAA\(3')GAGAAGCTTTTGAACTAGCCGGGAC
CAAGTTGAGGTATTTCTTGAGTGAAGAGCTCTCTGAAGTTCATTATTCAACCACTTCATGCATATACTTTGAGAAGAGGATCAGAAAGAA
ATTCTGCCATCTCGCTTTGGAGAGAGGATAAGGCTGCAGTCACCACATTTGCCTCTGTAATTTCCTGTAATGAGTAATGAGAAAAAACAA
TCTTTACAGATTCAAGATGAACTATATAGCAGTGACATTCATTTATTGTTGTTTTTATCTATCAAGTTTCCACCATTACAATTGTAATCT
CATCTGGTTTGAATTATGTTGTTAAATATAATCATTCAAGGTTGACACAAAAAAAAAAAAAAAAAACTCGAGACTAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan