ESTScan Details for Unigene SGN-U276294

Score 
11
Direction 
Forward
Predicted Peptide Sequence 
MGSFMYIAILLLAKSQPFIPARHXDRAALLSFRAALNESYLGIFNSWKGYDCCHEWYGVSCDPTTHRVADINLRGESEDPLFEKAHRTGY
MTGTISPSICKLERLSSLTIADWKGITGPIPSCITSLPFLRIIDLVGNKLTGSIPSTIGRLSRLTVLKVAENQLTGYIPRSLTNLSSXNA
ILDLPENNFHLCENIPNQISGKX
Predicted Coding Sequence 
ATGGGCAGCTTCATGTACATTGCGATCTTACTTCTTGCCAAATCTCAACCGTTCATTCCTGCCCGCCATCAXGATCGGGCAGCATTATTA
TCTTTCCGAGCTGCCCTAAATGAATCTTACTTAGGAATTTTCAACTCATGGAAAGGCTACGACTGTTGCCATGAATGGTACGGGGTGAGT
TGTGATCCCACAACTCACCGCGTAGCAGACATAAACCTCCGCGGTGAATCCGAAGATCCACTCTTCGAAAAAGCTCATCGTACCGGCTAC
ATGACCGGTACGATCTCTCCATCTATATGCAAATTAGAAAGACTATCAAGTCTCACTATAGCTGATTGGAAAGGCATCACTGGACCTATA
CCATCATGTATTACGTCCTTACCCTTCCTCCGAATCATCGACTTAGTCGGAAACAAGCTCACCGGCTCAATCCCTTCAACTATAGGTCGA
TTAAGTCGACTCACAGTGTTAAAAGTAGCTGAAAATCAACTTACTGGCTACATACCTCGATCATTAACCAATTTATCATCTTTXAATGCC
ATTTTAGATCTCCCGGAAAACAACTTCCATCTATGCGAAAACATCCCCAACCAAATTTCGGGAAAAATX\
Edits in Original Sequence 
CAATTTAGAAAATTTTAGAGAGAGAAACTGAATTTCAGAGAGAGAAACAAAACAAAAACACCTCAGG(5')ATGGGCAGCTTCATGTACA
TTGCGATCTTACTTCTTGCCAtAATCTCAACCGTTCATTCCTGCCCGCCATCAXGATCGGGCAGCATTATTATCTTTCCGAGCTGCCCTA
AATGAATCTTACTTAGGAATTTTCAACTCATGGAAAGGCTACGACTGTTGCCATGAATGGTACGGGGTGAGTTGTGATCCCACAACTCAC
CGCGTAGCAGACATAAACCTCCGCGGTGAATCCGAAGATCCACTCTTCGAAAAAGCTCATCGTACCGGCTACATGACCGGTACGATCTCT
CCATCTATATGCAAATTAGAAAGACTATCAAGTCTCACTATAGCTGATTGGAAAGGCATCACTGGACCTATACCATCATGTATTACGTCC
TTACCCTTCCTCCGAATCATCGACTTAGTCGGAAACAAGCTCACCGGCTCAATCCCTTCAACTATAGGTCGATTAAGTCGACTCACAGTG
TTAAAAcGTAGCTGAAAATCAACTTACTGGCTACATACCTCGATCATTAACCAATTTATCATCTTTXAATGCCATTTTAGATCTCCCGGA
AAACAACTTCCATCTATGCGAAAACATCCCCAACCAAATTTCGGGAAAAATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan