ESTScan Details for Unigene SGN-U276326

Score 
258
Direction 
Forward
Predicted Peptide Sequence 
SHIFHVAQPFISTLANVRPMLLVGGLEVKKDRGGRSEFVDRSXTPGRLYDIMERMDILDFRDLEILILDEADRLLGMGFEKQINSIISHL
PKLRRTSSLLLKLRQLKNFKGMIEKSCQVEVWAEIKQLSGFAPGNSTSSKTSSGLHIEYIECEAGQEIITACTSPMKNNYFMTCACVDCW
GTXSSMSLLSEKFFVNLSSRKDKAVYCPPQDDKMFIHRVGRTAXAGPDRTCCCFSVAKGGSISGVLAYX
Predicted Coding Sequence 
XXGTCACATATATTTCACGTTGCTCAACCGTTCATTTCCACATTAGCAAATGTTAGGCCTATGCTTCTTGTTGGGGGATTAGAAGTAAAG
AAAGATAGAGGAGGAAGGAGCGAATTTGTTGATCGATCGGXGACACCTGGGAGGCTATATGACATAATGGAGCGCATGGATATACTGGAC
TTTCGGGATCTTGAGATCCTGATATTAGATGAGGCTGATCGGCTATTAGGCATGGGATTCGAGAAGCAGATAAATTCAATCATTTCTCAT
TTACCTAAGCTTCGTAGAACGTCTTCTCTGCTACTCAAACTGAGGCAGTTGAAGAACTTCAAAGGTATGATTGAGAAATCCTGTCAGGTT
GAAGTTTGGGCAGAAATAAAACAGTTAAGCGGTTTTGCGCCTGGGAATTCAACCTCGTCAAAAACTTCTTCTGGCCTTCATATTGAGTAT
ATTGAATGCGAAGCXGGACAAGAAATCATCACAGCTTGTACATCTCCTATGAAGAACAACTACTTCATGACTTGTGCTTGTGTTGATTGT
TGGGGAACTGXTTCTTCCATGTCTCTCTTGTCTGAAAAGTTTTTCGTTAATCTCTCTTCACGGAAAGATAAAGCAGTGTACTGCCCTCCT
CAGGATGATAAAATGTTTATACATAGAGTAGGCCGAACAGCTXATGCTGGGCCCGACAGGACGTGCTGTTGTTTTTCTGTTGCCAAAGGA
GGAAGCATAAGTGGAGTTCTTGCGTATTNA\
Edits in Original Sequence 
(5')XXGTCACATATATTTCACGTTGCTCAACCGTTCATTTCCACATTAGCAAATGTTAGGCCTATGCTTCTTGTTGGGGGATTAGAAGT
AAAGAAAGATAGAGGAGGAAGGAGCGAATTTGTTGATCGATCGGXGACACCTGGGAGGCTATATGACATAATGGAGCGCATGGATATACT
GGACTTTCGGGATCTTGAGATCCTGATATTAGATGAGGCTGATCGGCTATTAGGCATGGGATTCGAGAAGCAGATAAATTCAATCATTTC
TCATTTACCTAAGCTTCGTAGAACGTCTTCTCTGCTACTCAAACTGAGGCAGTTGAAGAACTaTCAAAGGTATGATTGAGAAATCCTGTC
AGGTTGAAGTTTGGGCAGAAATAAAACAGTTAAGCGGTTTTGCGCCTGGGAATTCAACCTCGTCAAAAACTTCTTCTGGCCTTCATATTG
AGTATATTGAATGCGAAGCXGGACAAGAAATCATCACAGCTTGTACATCTCCTATGAAGAACAACTACTTCATGACTTGTGCTTGTGTTG
ATTGTTGGGGAACTGXTTCTTCCATGTCTCTCTTGTCTGAAAAGTTTTTCGTTAATCTCTCTTCACGGAAAGATAAAGCAGTGTACTGCC
CTCCTCAGGATGATAAAATGTTTATACATAGAGTAGGCCGAACAGCTXATGCTGGGCCCGACAGGACGTGCTGTTGTTTTTCTGTTGCCA
AAGGAGGAAGCATAAGTGGAGTTCTTGCGTATTNA\(3')AAACGTTTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan