ESTScan Details for Unigene SGN-U276397

Score 
538
Direction 
Forward
Predicted Peptide Sequence 
SKEGIDGQVAGCHWFSVPLLVDQLIPVAIQSLAGVMLLSCNLSAKSLHVARVIPIPGETFIPTSLAAASSSNQLWMVMGASSLCTSDSAP
LARVKVLDGFCESNQDSVEQEARVLEDKDLPGSEQLLQTLQGSSFIEKDALSAAAAAVKTAMCNLLIKKQYPSENREFRKRGRNDKRVDK
KK
Predicted Coding Sequence 
TCAAAAGAAGGAATAGATGGACAGGTTGCTGGCTGTCACTGGTTCTCTGTGCCACTCCTGGTGGATCAACTAATCCCGGTGGCTATTCAG
AGCTTGGCAGGCGTCATGCTTTTGAGTTGCAACCTTTCAGCTAAATCTCTCCATGTTGCAAGAGTGATTCCAATTCCTGGGGAGACTTTT
ATTCCCACAAGCTTAGCAGCTGCCTCTTCATCGAATCAATTGTGGATGGTCATGGGTGCATCGAGTCTGTGTACTTCTGATTCAGCACCT
TTGGCTCGTGTGAAGGTTCTTGATGGTTTCTGCGAGAGCAACCAGGACTCTGTTGAGCAGGAGGCTCGTGTCTTAGAAGATAAAGATTTA
CCAGGTAGTGAACAACTCCTTCAAACGCTGCAGGGGAGTTCGTTCATTGAGAAAGATGCATTATCCGCAGCTGCAGCAGCAGTGAAAACA
GCAATGTGTAATCTGTTAATCAAGAAGCAGTACCCTTCTGAAAATCGAGAGTTTAGAAAGAGAGGGAGGAATGACAAGAGAGTAGATAAG
AAAAAATGA\
Edits in Original Sequence 
(5')TCAAAAGAAGGAATAGATGGACAGGTTGCTGGCTGTCACTGGTTCTCTGTGCCACTCCTGGTGGATCAACTAATCCCGGTGGCTAT
TCAGAGCTTGGCAGGCGTCATGCTTTTGAGTTGCAACCTTTCAGCTAAATCTCTCCATGTTGCAAGAGTGATTCCAATTCCTGGGGAGAC
TTTTATTCCCACAAGCTTAGCAGCTGCCTCTTCATCGAATCAATTGTGGATGGTCATGGGTGCATCGAGTCTGTGTACTTCTGATTCAGC
ACCTTTGGCTCGTGTGAAGGTTCTTGATGGTTTCTGCGAGAGCAACCAGGACTCTGTTGAGCAGGAGGCTCGTGTCTTAGAAGATAAAGA
TTTACCAGGTAGTGAACAACTCCTTCAAACGCTGCAGGGGAGTTCGTTCATTGAGAAAGATGCATTATCCGCAGCTGCAGCAGCAGTGAA
AACAGCAATGTGTAATCTGTTAATCAAGAAGCAGTACCCTTCTGAAAATCGAGAGTTTAGAAAGAGAGGGAGGAATGACAAGAGAGTAGA
TAAGAAAAAATGA\(3')GATCGGTGGACAAAGTTACATGGTATCTATGCTGGTGGGATGTTATCAGAGTATTTATAGTCCGAGTTGATT
TTGCTGCCAGCAGTGAGCAAGGTAGTGGCCTTCCAGCTCAAACTCGTAAACAGTTCCAATGATGAAAGAAATCGAATTTCGCCTTACTGT
GAAGTAGTTTTTTTCTGCTTTTAATCACAATTTGTGATATGATATGATATTGTCTACATTGTTTGCGAATTGTTCACCCTCATTGTAACT
TGTTTTAATTATTTACCTTGCATTAGTTCTGGTACTATACTGTAGCTAATTTTGCTGCTTTTGATATTGCCATAATTTAAAAGCCTTCAT
TTGCTTTGTTCAAAAAAAAAAAAAAAAAACTCGAAGACTAGTTCCTCTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan