ESTScan Details for Unigene SGN-U276551

Score 
430
Direction 
Forward
Predicted Peptide Sequence 
KRXTEDDFSTDYESSVPVDEPEKVEKVEKVHACKTFCDAASTSTSSVVTKQIELPAKPVVREDASSIIEMKRILDSADHYEALGVSRHKK
IDTLLLKKEYRKKAMLVHPDKNMGSPLASESFKKLQCGYEVLSDAVKKRDYDEQLRKEESKSVMQKSPSTPTRNPPTTAQKSRGVSTAQN
VATHTFGSAPIGXKVKARWCQDCCQYHQAKDGDGWVEYKGSLVFNRPQKAEIPRAFVCAEGKIFDVSEWAICQGMVVDQYHRRVPCEX
Predicted Coding Sequence 
AAACGTXTTACTGAGGATGACTTCTCCACAGATTATGAGTCATCAGTTCCTGTGGATGAACCTGAAAAGGTTGAAAAGGTTGAAAAGGTT
CACGCTTGCAAAACATTCTGTGACGCTGCTTCTACTTCTACTTCATCAGTTGTAACCAAACAGATAGAACTCCCAGCTAAGCCTGTAGTT
AGAGAAGATGCAAGTTCAATAATTGAGATGAAGCGGATATTAGATAGTGCGGATCATTATGAAGCACTAGGGGTTTCTCGGCATAAGAAA
ATTGACACTTTACTGTTGAAAAAAGAATATCGTAAAAAGGCAATGCTTGTGCACCCGGACAAAAACATGGGAAGTCCACTTGCCAGTGAA
TCATTTAAGAAACTTCAATGTGGATATGAGGTTCTTTCTGATGCTGTCAAGAAGCGAGACTATGATGAGCAACTCAGAAAGGAAGAATCT
AAGAGTGTAATGCAAAAATCACCTAGCACTCCAACCAGGAATCCTCCAACTACTGCTCAGAAGAGTCGAGGCGTATCCACTGCACAAAAT
GTGGCAACTCACACATTTGGATCTGCACCAATAGGAXCAAAGGTCAAGGCAAGATGGTGCCAGGATTGTTGTCAATATCACCAAGCCAAA
GATGGGGATGGATGGGTAGAGTACAAAGGATCATTGGTTTTTAATAGACCACAAAAGGCGGAGATACCTCGTGCTTTCGTTTGTGCTGAA
GGCAAGATATTTGATGTGTCAGAATGGGCCATATGTCAGGGCATGGTTGTAGACCAATACCATAGACGAGTTCCATGTGAACXX\
Edits in Original Sequence 
(5')AAACGTXTTACTGAGGATGACTTCTCCACAGATTATGAGTCATCAGTTCCTGTGGATGAACCTGAAAAGGTTGAAAAGGTTGAAAA
GGTTCACGCTTGCAAAACATTCTGTGACGCTGCTTCTACTTCTACTTCATCAGTTGTAACCAAACAGATAGAACTCCCAGCTAAGCCTGT
AGTTAGAGAAGATGCAAGTTCAATAATTGAGATGAAGCGGATATTAGATAGTGCGGATCATTATGAAGCACTAGGGGTTTCTCGGCATAA
GAAAATTGACACTTTACTGTTGAAAAAAGAATATCGTAAAAAGGCAATGCTTGTGCACCCGGACAAAAACATGGGAAGTCCACTTGCCAG
TGAATCATTTAAGAAACTTCAATGTGGATATGAGGTTCTTTCTGATGCTGTCAAGAAGCGAGACTATGATGAGCAACTCAGAAAGGAAGA
ATCTAAGAGTGTAATGCAAAAATCACCTAGCACgTCCAACCAGGAATCCTCCAACTACTGCTCAGAAGAGTCGAGGCGTATCCACTGCAC
AAAATGTGGCAACTCACACATTTGGATCTGCACCAATAGGAXCAAAGGTCAAGGCAAGATGGTGCCAGGATTGTTGTCAATATCACCAAG
CCAAAGATGGGGATGGATGGGTAGAGTACAAAGGATCATTGGTTTTTAATAGACCACAAAAGGCGGAGATACCTCGTGCTTTCGTTTGTG
CTGAAGGCAAGATATTTGATGTGTCAGAATGGGCCATATGTCAGGGCATGGTTGTAGACCAATACCATAGACGAGTTCCATGTGAACXX\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan