ESTScan Details for Unigene SGN-U276660

Score 
242
Direction 
Forward
Predicted Peptide Sequence 
EINATAMEINAMAMEIRXNYSGVRHTDSVIWHNDGGIRHNGGGVQHNGSEIQHIGAIDEKKEESKPPTSLHKLTVSSPYSYRQIHHRHCL
IFEQIEFEXPDLVSNKIGAKLQIAIKLSIXGVRFLISYLKDMAYIMDTNEEERVQGITVEVGRAPFEIETTRFTILGAPVTFYPHSFSGL
PCTREEQV
Predicted Coding Sequence 
GAAATCAACGCAACGGCGATGGAAATCAACGCGATGGCGATGGAAATTCGCAXCAACTACAGTGGAGTTAGGCACACTGACAGTGTAATC
TGGCACAACGACGGTGGAATCCGGCACAACGGTGGTGGAGTTCAGCACAACGGTAGTGAAATTCAGCACATCGGTGCTATTGATGAGAAG
AAAGAGGAATCAAAGCCGCCGACGTCTCTTCACAAGCTCACCGTCAGCAGTCCGTATTCGTATAGGCAAATTCATCATCGCCATTGCCTC
ATATTCGAGCAGATCGAATTTGAAXCTCCTGATCTTGTGTCCAATAAAATTGGTGCAAAATTGCAGATAGCAATCAAACTATCTATTGXT
GGAGTTCGATTTTTGATCTCCTATTTGAAGGATATGGCCTATATTATGGATACAAATGAAGAAGAGAGGGTGCAGGGAATAACAGTTGAA
GTAGGAAGAGCACCTTTTGAAATAGAGACGACTAGGTTTACAATTCTTGGTGCCCCGGTAACCTTTTATCCTCATTCTTTCTCTGGTTTA
CCTTGTACACGGGAGGAACAGGTGTGA\
Edits in Original Sequence 
(5')GAAATCAACGCAACGGCGATGGAAATCAACGCGATGGCGATGGAAATTCGCAXCAACTACAGTGGAGTTAGGCACACTGACAGTGT
AATCTGGCACAACGACGGTGGAATCCGGCACAACGGTGGTGGAGTTCAGCACAACGGTAGTGAAATTCAGCACATCGGTGCTATTGATGA
GAAGAAAGAGGAATCAAAGCCGCCGACGTCTCTTCACAAGCTCACCGTCAGCAGTCCGTATTCGTATAGGCAAATTCATCATCGCCATTG
CCTCATATTCGAGCAGATCGAATTTGAAXCTCCTGATCTTGTGTCCAATAAAATTGGTGCAAAATTGCAGATAGCAATCAAACTATCTAT
TGXTGGAGTTCGATTTTTGATCTCCTATTTGAAGGtATATGGCCTATATTATGGATACAAATGAAGAAGAGAGGGTGCAGGGAATAACAG
TTGAAGTAGGAAGAGCACCTTTTGAAATAGAGACGACTAGGTTTACAATTCTTGGTGCCCCGGTAACCTTTTATCCTCATTCTTTCTCTG
GTTTACCTTGTACACGGGAGGAACAGGTGTGA\(3')GTATTAAGTGACAAGTTTATGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan