ESTScan Details for Unigene SGN-U276696

Score 
285
Direction 
Forward
Predicted Peptide Sequence 
LNNYDQLRTGSNKALEVARSGKLIGSSLEAKLYLHCSNESLAERLNKMCEPTNEADALHRIFITSQVEILNSLQDERIKDVQYTGEYLME
EGDKIWIGVSRANGSKCDRCWNYSPQVGSFTEHPLLCGRCHTVVISLQARDLDDLSKVTHSEAKEAKHNELNQYIMIHKSGGLQLLQAVI
LVSSKSFNFITKYEASTQVFHVIH
Predicted Coding Sequence 
TTGAACAACTATGACCAGCTAAGGACXGGAAGTAACAAAGCATTAGAAGTAGCTCGAAGTGGAAAATTGATTGGTTCCAGTTTAGAGGCC
AAGTTGTATCTCCATTGTTCTAATGAAAGCCTGGCTGAGAGACTAAACAAAATGTGTGAACCTACAAATGAGGCAGATGCTTTACATCGC
ATATTTATAACATCTCAGGTGGAGATTCTCAACTCATTGCAAGATGAAAGGATTAAAGATGTTCAGTACACTGGAGAATACCTCATGGAA
GAAGGGGACAAAATCTGGATTGGTGTATCTCGTGCAAATGGCTCGAAATGTGACAGATGCTGGAATTATTCACCTCAAGTAGGTTCTTTT
ACTGAGCATCCTTTGCTATGTGGCCGCTGTCACACCGTGGTTATCAGTCTACAAGCTCGTGATCTTGATGATTTATCCAAGGTCACACAC
AGTGAAGCAAAGGAGGCTAAGCACAATGAACTTAATCAATATATCATGATCCACAAATCTGGAGGTTTACAGCTACTACAAGCTGTAATT
CTTGTGTCTTCAAAAAGTTTTAATTTCATTACCAAATATGAGGCATCAACCCAAGTCTTTCATGTAATTCATTAG\
Edits in Original Sequence 
(5')TTGAACAACTATGACCAGCTAAGGACXGGAAGTAACAAAGCATTAGAAGTAGCTCGAAGTGGAAAATTGATTGGTTCCAGTTTAGA
GGCCAAGTTGTATCTCCATTGTTCTAATGAAAGCCTGGCTGAGAGACTAAACAAAATGTGTGAACCTACAAATGAGGCAGATGCTTTACA
TCGCATATTTATAACATCTCAGGTGGAGATTCTCAACTCATTGCAAGATGAAAGGATTAAAGATGTTCAGTACACTGGAGAATACCTCAT
GGAAGAAGGGGACAAAATCTGGATTGGTGTATCTCGTGCAAATGGCTCGAAATGTGACAGATGCTGGAATTATTCACCTCAAGTAGGTTC
TTTTACTGAGCATCCTTTGCTATGTGGCCGCTGTCACACCGTGGTTATCAGTCTACAAGCTCGTGATCTTGATGATTTATCCAAGGTCAC
ACACAGTGAAGCAAAGGAGGCTAtAGCACAATGAACTTAATCAATATATCATGATCCACAAATCTGGAGGTTTACAGCTACTACAAGCTG
TAATTCTTGTGTCTTCAAAAAGTTTTAATTTCATTACCAAATATGAGGCATCAACCCAAGTCTTTCATGTAATTCATTAG\(3')AATAG
AGAAAGAAAAACACAGAGATATCTTTTTTTTTATAAGTTAGGATAGTATTTTTGTACATGCATTGATGAATAGAAAGATAGTGATTTAAC
TGGTATTGTGATGTTTTTTGTAATCGATTTGATTCAGACCTTATTTAACAAATCCAACAGTATATTACAGGATTAATTTAAAAAAAGAAA
AAAAAAACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan