ESTScan Details for Unigene SGN-U276761

Score 
605
Direction 
Reverse
Predicted Peptide Sequence 
MQVIPKWRNVLILKNSLIQSTRIVSSTQSPNTHLSSFHSTSICSEKWKNKWNSDFGGSQQPTKNYIRYETRQKRADSKKALKNLLFYGAS
GNSFENESSTINDRWDMDRDDRSEKKSEYKSAARLRDRSRRRMRKMKKRRLCEEFDEYPEPIFEATFGNKWYTWSFRPGKSSTFEDLFPE
DKKQTGQNKGITDGDNETENETHTESKYGSCNIGSYSERTILGLPPRGPLKIEDVKNAFRLSALKWHPDKHQGPSQAAAEEKFKTCVTAY
KSLCNAFSPA
Predicted Coding Sequence 
ATGCAAGTAATACCCAAATGGCGTAATGTTTTGATCTTGAAGAATTCACTTATTCAATCCACAAGAATAGTATCTTCTACACAATCACCA
AATACCCATTTGAGTTCTTTCCATTCTACCTCAATTTGCTCTGAGAAATGGAAAAATAAGTGGAATTCTGATTTTGGAGGAAGTCAGCAG
CCAACTAAGAATTATATCAGATATGAAACACGTCAAAAGCGTGCTGACTCAAAAAAAGCTTTGAAAAATCTTCTCTTTTATGGAGCATCT
GGAAACTCTTTTGAGAATGAATCTTCAACAATAAATGATAGATGGGATATGGATCGGGATGATCGTTCAGAGAAGAAAAGTGAATATAAG
TCCGCTGCTCGTCTTAGAGATCGCTCGAGGAGAAGAATGCGAAAAATGAAGAAACGGAGATTATGTGAAGAATTCGATGAATATCCTGAA
CCAATATTCGAAGCAACTTTTGGTAATAAGTGGTACACTTGGTCTTTTAGGCCTGGTAAATCATCTACTTTTGAAGATCTGTTCCCCGAA
GACAAGAAACAGACTGGTCAGAACAAAGGCATTACAGATGGXGATAATGAAACTGAAAACGAGACACATACAGAATCCAAATATGGATCA
TGTAATATAGGGTCTTACTCTGAAAGAACAATTCTCGGTTTGCCCCCAAGAGGTCCTCTGAAGATTGAGGATGTCAAGAATGCTTTCCGT
TTATCAGCATTAAAGTGGCATCCTGATAAACATCAAGGCCCTTCACAGGCAGCAGCAGAAGAGAAATTTAAAACTTGCGTCACTGCATAC
AAGTCATTGTGCAACGCGTTCTCCCCAGCTTAA\
Edits in Original Sequence 
TTTTCCCCCAAAACAGCTCCTTCCTTCCTTCCCCACTTGTAAGCAACTAAAAGACACCATTGATGATTCATTCTTGTACAAAAAAATCGA
AAAAAACTTCATTTTTTTACCTTTTATATTTCACTTTTTGGGTCGTTTTCAAAATTTCAAGAAA
(5')ATGCAAGTAATACCCAAATGGC
GTAATGTTTTGATCTTGAAGAATTCACTTATTCAATCCACAAGAATAGTATCTTCTACACAATCACCAAATACCCATTTGAGTTCTTTCC
ATTCTACCTCAATTTGCTCTGAGAAATGGAAAAATAAGTGGAATTCTGATTTTGGAGGAAGTCAGCAGCCAACTAAGAATTATATCAGAT
ATGAAACACGTCAAAAGCGTGCTGACTCAAAAAAAGCTTTGAAAAATCTTCTCTTTTATGGAGCATCTGGAAACTCTTTTGAGAATGAAT
CTTCAACAATAAATGATAGATGGGATATGGATCGGGATGATCGTTCAGAGAAGAAAAGTGAATATAAGTCCGCTGCTCGTCTTAGAGATC
GCTCGAGGAGAAGAATGCGAAAAATGAAGAAACGGAGATTATGTGAAGAATTCGATGAATATCCTGAACCAATATTCGAAGCAACTTTTG
GTAATAAGTGGTACACTTGGTCTTTTAGGCCTGGTAAATCATCTACTTTTGAAGATCTGTTCtCCCGAAGACAAGAAACAGACTGGTCAG
AACAAAGGCATTACAGATGGXGATAATGAAACTGAAAACGAGACACATACAGAATCCAAATATGGATCATGTAATATAGGGTCTTACTCT
GAAAGAACAATTCTCGGTTTGCCCCCAAGAGGTCCTCTGAAGATTGAGGATGTCAAGAATGCTTTCCGTTTATCAGCATTAAAGTGGCAT
CCTGATAAACATCAAGGCCCTTCACAGGCAGCAGCAGAAGAGAAATTTAAAACTTGCGTCACTGCATACAAGTCATTGTGCAACGCGTTC
TCCCCAGCTTAA\(3')CCTTTATCTGACGTATCCATGGTTTCTTTTCTTCGAGTTTCAGAAGCCAAAATCACCATTCATAGTATAATAA
TAGCTAGCTGAGTCTTCTGTATTCTAATTTAGTTCTGTATGATTACTTCCATCACTCTTGCAATAAGGGGGGCTCTTTCTTCCCAGCAGA
GTCATGAAAATGTACTTAGTAAAATTTTGGAGTCTTGTATACAACCAAAGATCCATGCAAAACATAAACCAGTTGCTTGGTTTCTGAAAA
TAGGATGTGATCATACCAGTACTATCGCATCGGATTCCATGAGTTAAGCATGCTTCGATGAGAGTAGTACTAGAATGGGTGATTCTTGCT
TGGTTGCTTTGCATTCTTTTATAATATTGTTATTTTTTGGTAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan