ESTScan Details for Unigene SGN-U276807

Score 
572
Direction 
Forward
Predicted Peptide Sequence 
MNSIPFSIVTYIPSKQPLLLCTKNSQTTTDPIPHFIKSSILSSSSKSVNKLAETISPLSFSFSRRETLSAXRIGFFGDFVRGSFAAESNI
EAIAEEAAATECEFTVTPSGLAYCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRVGVGEVIKGWDQGILGGGKRKLK
IPPELGYGIRGAGCRGGTCIIPPDSVLLFDVEFLARRRFQQQRLTGSSMGKFFVSCSANX
Predicted Coding Sequence 
ATGAATTCCATTCCTTTCTCCATTGTTACATACATTCCTTCAAAGCAGCCATTGTTACTCTGTACCAAAAATTCCCAAACAACAACTGAT
CCAATTCCACATTTTATCAAATCCTCAATACTCTCGTCTTCTTCGAAATCTGTGAATAAACTCGCAGAAACAATTAGTCCATTGTCATTT
TCGTTCAGTAGAAGAGAAACCCTAAGTGCTXTTCGGATTGGGTTTTTCGGCGATTTTGTTCGAGGCTCTTTTGCAGCCGAGTCGAATATT
GAAGCAATTGCTGAAGAAGCTGCAGCTACGGAATGTGAATTCACAGTTACACCTTCAGGTCTTGCTTATTGTGATAAAGTTGTGGGTTAT
GGACCTGAAGCTGTTAAAGGACAATTGATCAAGGCACATTATGTAGGTAAACTGGAAAACGGGAAGGTCTTTGATAGCAGCTACAATCGT
GGAAAGCCTCTTACATTTCGCGTTGGTGTTGGCGAGGTTATTAAAGGCTGGGATCAGGGAATTCTAGGAGGAGGAAAGCGTAAACTAAAG
ATTCCTCCAGAACTTGGATATGGGATAAGAGGAGCTGGCTGCAGAGGAGGTACATGCATTATTCCTCCAGACTCTGTTCTATTGTTCGAT
GTGGAGTTCTTGGCAAGGCGTAGATTTCAGCAACAGAGGTTAACTGGTTCATCAATGGGCAAATTTTTTGTAAGCTGCAGCGCAAATGXX
\
Edits in Original Sequence 
GTCTTTCTTATCTGTTCTAAAATTTTCTGTTTGGTGGAA(5')ATGAATTCCATTCCTTTCTCCATTGTTACATACATTCCTTCAAAGCA
GCCATTGTTACTCTGTACCAAAAATTCCCAAACAACAACTGATCCAATTCCACATTTTATCAAATCCTCAATACTCTCGTCTTCTTCGAA
ATCTGTGAATAAACTCGCAGAAACAATTAGTCCATTGTCATTTTCGTTCAGTAGAAGAGAAACCCTAAGTGCTXTTCGGATTGGGTTTTT
CGGCGATTTTGTTCGAGGCTCTTTTGCAGCCGcAGTCGAATATTGAAGCAATTGCTGAAGAAGCTGCAGCTACGGAATGTGAATTCACAG
TTACACCTTCAGGTCTTGCTTATTGTGATAAAGTTGTGGGTTATGGACCTGAAGCTGTTAAAGGACAATTGATCAAGGCACATTATGTAG
GTAAACTGGAAAACGGGAAGGTCTTTGATAGCAGCTACAATCGTGGAAAGCCTCTTACATTTCGCGTTGGTGTTGGCGAGGTTATTAAAG
GCTGGGATCAGGGAATTCTAGGAGGAGGAAAGCGTAAACTAAAGATTCCTCCAGAACTTGGATATGGGATAAGAGGAGCTGGCTGCAGAG
GAGGTACATGCATTATTCCTCCAGACTCTGTTCTATTGTTCGATGTGGAGTTCgTTGGCAAGGCGTAGATTTCAGCAACAGAGGTTAACT
GGTTCATCAATGGGCAAATTTTTTGTAAGCTGCAGCGCAAATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan