ESTScan Details for Unigene SGN-U276866

Score 
393
Direction 
Forward
Predicted Peptide Sequence 
KKSILIIRDKRKRETHEKKSQTEXKKEKKQLRREGWVGYGGKSNGTVKHRGRIVIIDSFLSPSPSPCSISSSPPSLLMLLNPSAPESVKL
GGVFIGVNGGNGGAFWMDRQPSNAGIAFAVTALAGLALAAAVFYTTRGHLKSPWSRRKRKRALAPQQWRSFFTPEGKLRDGGIKFLKKVR
SGGVDPSIRAEVWPFLLGVYELNSSKEERDCIRNQKRREYESYRRECRRLLKRNGSFXMRETGGMGSDGEGNITEGIDSP
Predicted Coding Sequence 
XAGAAAAAGAGCATACTGATTATTAGAGACAAAAGAAAGAGAGAGACTCATGAGAAGAAGAGCCAAACCGAAGXTAAAAAAGAGAAAAAG
CAGTTGAGAAGGGAAGGTTGGGTTGGTTATGGTGGAAAATCTAATGGCACGGTGAAGCATAGGGGTAGAATCGTCATTATAGATTCCTTT
CTCTCTCCATCTCCATCTCCATGCTCAATCTCTTCTTCACCTCCGTCGCTTCTAATGTTGTTGAATCCATCGGCACCAGAATCAGTXAAG
CTCGGTGGAGTATTCATCGGCGTTAACGGAGGAAACGGTGGTGCTTTCTGGATGGACCGTCAACCTTCGAATGCCGGTATAGCTTTTGCT
GTCACGGCCTTGGCCGGTCTCGCCTTGGCCGCCGCCGTTTTCTACACTACTAGAGGTCATCTCAAATCACCATGGTCTCGTAGAAAAAGA
AAACGTGCTCTTGCACCCCAACAGTGGAGAAGTTTTTTCACACCAGAAGGAAAACTTCGTGATGGTGGAATTAAATTTCTAAAGAAAGTC
CGAAGTGGAGGTGTTGATCCTAGTATCAGGGCCGAGGTTTGGCCATTTCTCCTGGGAGTCTATGAGTTGAACAGCTCTAAAGAAGAAAGA
GATTGTATAAGAAATCAGAAGAGGAGGGAATATGAGAGCTATCGTAGAGAATGTCGCAGACTGCTGAAACGCAATGGGTCCTTTAXAATG
AGGGAAACTGGTGGAATGGGAAGCGATGGTGAAGGAAATATCACTGAAGGGATTGATTCCCCX\
Edits in Original Sequence 
(5')XAGAAAAAGAGCATACTGATTATTAGAGACAAAAGAAAGAGAGAGACTCATGAGAAGAAGAGCCAAACCGAAGXTAAAAAAGAGAA
AAAGCAGTTGAGAAGGGAAGGTTGGGTTGGTTATGGTGGAAAATCTAATcGGCACGGTGAAGCATAGGGGTAGAATCGTCATTATAGATT
CCTTTCTCTCTCCATCTCCATCTCCATGCTCAATCTCTTCTTCACCTCCGTCGCTTCTAATGTTGTTGAATCCATCGGCACCAGAATCAG
TXAAGCTCGGTGGAGTATTCATCGGCGTTAACGGAGGAAACGGTGGTGCTTTCTGGATGGACCGTCAACCTTCGAATGCCGGTATAGCTT
TTGCTGTCACGGCCTTGGCCGGTCTCGCCTTGGCCGCCGCCGTTTTCTACACTACTAGAGGTCATCTCAAATCACCATGGTCTCGTAGAA
AAAGAAAACGTGCTCTTGCACCCCAACAGTGGAGAAGTTTTTTCACACCAGAAGGAAAACTTCGTGATGGTGGAATTAAATTTCTAAAGA
AAGTCCGAAGTGGAGGTGTTGATCCTAGTATCAGGGCCGAGGTTTGGCCATTTCTCCTGGGAGTCTATGAGTTGAACAGCTCTAAAGAAG
AAAGAGATTGTATAAGAAATCAGAAGAGGAGGGAATATGAGAGCTATCGTAGAGAATGTCGCAGACTGCTGAAACGCAATGGGTCCTTTA
XAATGAGGGAAACTGGTGGAATGGGAAGCGATGGTGAAGGAAATATCACTGAAGGGATTGATTCCCCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan