ESTScan Details for Unigene SGN-U276867

Score 
446
Direction 
Forward
Predicted Peptide Sequence 
PNRSKKEEKAVEEGKVGLVMVENLIGTVKHRGRIVIIDSFLSPSPSPCSISSSPPSXSNVVESIGNRISKLGGVFIGVNGGNGGAFWMDR
QPSNAGIAFAVTALAGLALAAAVFYTTXVKKESPAEIYSTYCKQKGIIXKKEPGIIETLEICRVDLSFFFLSTVKNSSVEVDESSQTKSD
FVIFKFLFTVFIITIIIDIVVDSFEISSIVVASSPASSSSNRGHLKSPWSRRKRKRALAPQQWRSFFTPEGKLRDGGIKFLKKVRSGGVD
PSIXAEVWPFLLGVYELN
Predicted Coding Sequence 
CCAAACCGAAGTAAAAAAGAAGAAAAAGCAGTTGAAGAAGGAAAGGTTGGGTTGGTTATGGTGGAAAATCTAATCGGCACGGTGAAGCAT
AGGGGTAGAATCGTCATTATAGATTCCTTTCTCTCTCCATCTCCATCTCCATGCTCAATCTCTTCTTCACCTCCGTCGXCTTCTAATGTT
GTTGAATCCATCGGCAATAGAATCAGTAAGCTCGGTGGAGTATTCATCGGCGTTAACGGAGGAAACGGTGGTGCTTTCTGGATGGACCGT
CAACCTTCGAATGCCGGTATAGCTTTTGCTGTCACGGCCTTGGCCGGTCTCGCCTTGGCCGCCGCCGTTTTCTACACTACTAGXGTAAAA
AAAGAATCTCCGGCTGAAATTTACTCAACGTATTGTAAGCAAAAAGGAATTATTGAXAAAAAGGAACCTGGAATTATTGAAACCCTAGAA
ATCTGTAGAGTAGATCTTTCTTTCTTTTTTCTATCCACAGTTAAAAACAGCAGTGTAGAAGTAGATGAGAGCTCTCAGACGAAGTCAGAC
TTCGTCATCTTCAAATTCCTCTTCACCGTCTTCATCATCACCATCATCATCGACATCGTCGTGGATTCATTTGAGATCAGTTCTATTGTT
GTTGCCTCCTCACCAGCTTCTTCTTCCTCTAATCGAGGTCATCTCAAATCACCATGGTCTCGTAGAAAAAGAAAACGTGCTCTTGCACCC
CAACAGTGGAGAAGCTTTTTCACACCAGAAGGAAAACTTCGTGATGGTGGAATTAAATTTCTAAAGAAAGTCCGAAGTGGAGGTGTTGAT
CCTAGTATCANGGCCGAGGTTTGGCCATTTCTCCTGGGAGTCTATGAGTTGAAC\
Edits in Original Sequence 
(5')CCAAACCGAAGTAAAAAAGAAGAAAAAGCAGTTGAAGAAGGAAAGGTTGGGTTGGTTATGGTGGAAAATCTAATCGGCACGGTGAA
GCATAGGGGTAGAATCGTCATTATAGATTCCTTTCTCTCTCCATCTCCATCTCCATGCTCAATCTCTTCTTCACCTCCGTCGXCTTCTAA
TGTTGTTGAATCCATCGGCAATAGAATCAGTAAGCTCGGTGGAGTATTCATCGGCGTTAACGGAGGAAACGGTGGTGCTTTCTGGATGGA
CCGTCAACCTTCGAATGCCGGTATAGCTTTTGCTGTCACGGCCTTGGCCGGTCTCGCCTTGGCCGCCGCCGTTTTCTACACTACTAGXGT
AAAAAAAGAATCTCCGGCTGAAATTTACTCAACGTATTGTAAGCAAAAAGGAATTATTGAXAAAAAGGAACCTGGAATTATTGAAACCCT
AGAAATCTGTAGAGTAGATCTTTCTTTCTTTTTTCTATCCACAGTTAAAAACAGtCAGTGTAGAAGTAGATGAGAGCTCTCAGACGAAGT
CAGACTTCGTCATCTTCAAATTCCTCTTCACCGTCTTCATCATCACCATCATCATCGACATCGTCGTGGATTCATTTGAGATCAGTTCTA
TTcGTTGTTGCCTCCTCACCAGCTTCTTCTTCCTCTAATCGAGGTCATCTCAAATCACCATGGTCTCGTAGAAAAAGAAAACGTGCTCTT
GCACCCCAACAGTGGAGAAGCTTTTTCACACCAGAAGGAAAACTTCGTGATGGTGGAATTAAATTTCTAAAGAAAGTCCGAAGTGGAGGT
GTTGATCCTAGTATCANGGCCGAGGTTTGGCCATTTCTCCTGGGAGTCTATGAGTTGAAC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan