ESTScan Details for Unigene SGN-U276870

Score 
838
Direction 
Reverse
Predicted Peptide Sequence 
MWFIVFLYTKLSKTIFTTISSNSAAAFEYASNALAKIIVSIRPHEIGEILDTFKCISIINAHTLIKRNKWDLPNITIQRFTRLIXVLFSE
LEDQTTLLVLEKHHHGYLMRLYHIMLQNNHTLQEHKQLLYXALDHEFVPGSKFSMVKSITGSLWETVREXHGFFLITFFVALYDKVSLNI
HDDVFQALEELFDLPTQKKVQNKSSKPLYGYVGQIPFIPLYESMGIDNANTLEGIQNFTNFMWPNGNNDFSQALLAYSKAAAELEEMVVK
MVFESYGVEKYYEPHVKSVNYLARVMKYREAQVEEAKWXFVAHTDKSFMSTIHQTXQVNGLGDQGKDGPVVLEFELSPFXIRRHGWGTRS
W
Predicted Coding Sequence 
ATGTGGTTCATAGTATTTCTCTACACCAAGCTCTCAAAAACCATTTTCACCACCATTTCTTCTAATTCTGCTGCTGCTTTTGAGTATGCT
AGCAATGCXTTGGCTAAAATCATTGTTTCCATTAGGCCACATGAAATTGGTGAAATTTTGGATACCTTCAAGTGTATTAGCATTATCAAT
GCCCATACTCTCATAAAGAGGAATAAATGGGATTTGCCCAACATAACCATACAAAGGTTTACTAGACTTATTXTTGTACTTTTTTCTGAG
TTGGAAGATCAAACAACTCTTCTAGTGCTTGAAAAACATCATCATGGATATTTAATGAGACTTTATCATATAATGCTACAAAACAACCAT
ACTCTTCAAGAGCACAAACAGCTTCTTTACXTTGCTTTGGACCATGAATTTGTACCTGGTTCCAAATTCTCCATGGTGAAATCAATAACA
GGAAGTTTGTGGGAAACTGTTAGAGAAXCCCATGGATTTTTTTTAATTACTTTTTTTGTCGCATTATATGATAAAGTCTCATTAAATATC
CATGATGATGTTTTTCAAGCACTAGAAGAGTTGTTTGATCTTCCAACTCAGAAAAAAGTACAAAATAAGTCTAGTAAACCTTTGTATGGT
TATGTTGGGCAAATCCCATTTATTCCTCTTTATGAGAGTATGGGCATTGATAATGCTAATACACTTGAAGGTATCCAAAATTTCACCAAT
TTCATGTGGCCTAATGGAAACAATGATTTTAGCCAAGCATTGCTAGCATACTCAAAAGCAGCAGCAGAATTAGAAGAAATGGTGGTGAAA
ATGGTTTTTGAGAGCTATGGTGTAGAGAAATACTATGAACCACATGTCAAATCAGTGAATTATCTAGCTAGAGTAATGAAATATAGAGAA
GCACAAGTAGAAGAAGCAAAATGGGNATTTGTTGCTCATACAGACAAGAGCTTCATGTCAACAATTCATCAGACTNATCAAGTTAATGGT
TTGGGAGATCAAGGGAAAGATGGACCAGTGGTTTTGGAATTTGAGCTTTCTCCTTTCTNCATTCGTCGTCATGGCTGGGGNACGCGATCA
TGG\
Edits in Original Sequence 
CCATGATCGCGTCCCCCAGCCATGACGACGATGGAGGAAGGAGAAAGCTCACTNNCCAAACCACTGTCCATTTTTCCCTTTGATCTCCAA
ACCATTAACTTGATTAGTCTGATGAATTGTTGACATGAAGCTCTTGTCTGTATGAGCAACAAATCCCAGTTTTGCTTCTTCTACTTGTGC
TTCTCTATATTTCATTACTCTAGCTAGATAATTCACTGATTTGAC
(5')ATGTGGTTCATAGTATTTCTCTACACCAtAGCTCTCAAAAA
CCATTTTCACCACCATTTCTTCTAATTCTGCTGCTGCTTTTGAGTATGCTAGCAATGCXTTGGCTAAAATCATTGTTTCCATTAGGCCAC
ATGAAATTGGTGAAATTTTGGATACCTTCAAGTGTATTAGCATTATCAATGCCCATACTCTCATAAAGAGGAATAAATGGGATTTGCCCA
ACATAACCATACAAAGGTTTACTAGACTTATTXTTGTACTTTTTTCTGAGTTGGAAGATCAAACAACTCTTCTAGTGCTTGAAAAACATC
ATCATGGATATTTAATGAGACTTTATCATATAATGCTACAAAACAACCATACTCTTCAAGAGCACAAACAGCTTCTTTACXTTGCTTTGG
ACCATGAATTTGTACCTGGTTCCAAATTCTCCATGGTGAAATCAATAACAGGAAGTTTGTGGGAAACTGTTAGAGAAXCCCATGGATTTT
TTTTAATTACTTTTTTTGTCGCATTATATGATAAAGTCTCATTAAATATCCATGATGATGTTTTTCAAGCACTAGAAGAGTTGTTTGATC
TTCCAACTCAGAAAAAAGTACAAAATAAGTCTAGTAAACCTTTGTATGGTTATGTTGGGCAAATCCCATTTATTCCTCTTTATGAGAGTA
TGGGCATTGATAATGCTAATACACTTGAAGGTATCCAAAATTTCACCAATTTCATGTGGCCTAATGGAAACAATGATTTTAGCCAAGCAT
TGCTAGCATACTCAAAAGCAGCAGCAGAATTAGAAGAAATGGTGGTGAAAATGGTTTTTGAGAGCTATGGTGTAGAGAAATACTATGAAC
CACATGTCAAATCAGTGAATTATCTAGCTAGAGTAATGAAATATAGAGAAGCACAAGTAGAAGAAGCAAAAcTGGGNATTTGTTGCTCAT
ACAGACAAGAGCTTCATGTCAACAATTCATCAGACTNATCAAGTTAATGGTTTGGGAGATCaAAGGGAAAGATGGACCAGTGGTTTTGGA
ATTTGAGCTTTCTCCTTTCTNCATTCGTCGTCATGGCTGGGGNACGCGATCATGG\(3')NNATCGATCTCATTTCATTTTTAATGTGTC
TTAATTTAACTGATTACTACGAAATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan