ESTScan Details for Unigene SGN-U276878

Score 
567
Direction 
Forward
Predicted Peptide Sequence 
LEKLSENNENEGCFHSFIDFGVFNFIEASDGMDVMHIAGKVLCQDCTQGWNEWVDGAKAIKGSIVSLTCLDERRRVMYYGSDLTDEVGIF
DLIVNQTCHGKTIKPQNCFVRLVSSPDPVCNIATDFAGGKSGVKLHRPTVVYRDLLKYVLSPFYYTTPMCDEPNINDDDNLETNDDKNQN
NY
Predicted Coding Sequence 
XCTTTAGAGAAATTAAGTGAGAATAATGAAAATGAAGGTTGTTTTCATAGTTTCATTGATTTTGGTGTTTTCAATTTCATTGAAGCCTCA
GATGGAATGGATGTCATGCATATTGCTGGCAAAGTTCTTTGCCAAGATTGTACTCAAGGATGGAATGAATGGGTTGATGGTGCTAAAGCC
ATCAAAGGTAGCATAGTATCTCTGACGTGTCTGGATGAGAGAAGAAGAGTGATGTATTACGGAAGTGACCTCACGGATGAAGTTGGAATT
TTCGACTTAATTGTTAACCAAACTTGTCATGGCAAAACAATTAAGCCACAAAATTGCTTTGTGAGATTGGTTTCTTCACCTGACCCTGTT
TGCAATATTGCCACCGACTTCGCCGGAGGAAAATCCGGTGTAAAGCTCCACCGTCCGACGGTGGTGTACCGGGACTTGCTCAAATATGTG
CTTAGCCCTTTCTACTACACAACTCCCATGTGTGATGAACCTAATATTAATGATGATGATAATTTGGAGACTAATGATGATAAAAATCAA
AACAACTATTAA\
Edits in Original Sequence 
(5')XCTTTAGAGAAATTAAGTGAGAATAATGAAAATGAAGGTTGTTTTCATAGTTTCATTGATTTTGGTGTTTTCtAATTTCATTGAAG
CCTCAGATGGAATGGATGTCATGCATATTGCTGGCAAAGTTCTTTGCCAAGATTGTACTCAAGGATGGAATGAATGGGTTGATGGTGCTA
AAGCCATCAAAGGTAGCATAGTATCTCTGACGTGTCTGGATGAGAGAAGAAGAGTGATGTATTACGGAAGTGACCTCACGGATGAAGTTG
GAATTTTCGACTTAATTGTTAACCAAACTTGTCATGGCAAAACAATTAAGCCACAAAATTGCTTTGTGAGATTGGTTTCTTCACCTGACC
CTGTTTGCAATATTGCCACCGACTTCGCCGGAGGAAAATCCGGTGTAAAGCTCCACCGTCCGACGGTGGTGTACCGGGACTTGCTCAAAT
ATGTGCTTAGCCCTTTCTACTACACAACTCCCATGTGTGATGAACCTAATATTAATGATGATGATAATTTGGAGACTAATGATGATAAAA
ATCAAAACAACTATTAA\(3')ATTAAGTTCTTGATTTTTTTAATGTTTGTTTTAAATTTCCCATTTTGCAAATGGAAAATGACAATTTA
TCTATGTTGGATGAGTTGATAATTTTATTTTGTACTATTAATTACGTGCAAAGGACATGTATAAGTTTGAATTATAAAGTCTCTCTTAGT
TTCAACTAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan