ESTScan Details for Unigene SGN-U276920

Score 
-25
Direction 
Forward
Predicted Peptide Sequence 
DSSGSSHRPAAKVFRFIHQKPRAQKLLIMAALPYADVDSSLKALAGRAEGFGRFAIGGLNGPVYSVTSLADDGPGSLRDGCRKKEPLWIV
FEVSGTIHLTSYLRVSSHKTIDGRGQRIKLTGKGLQLKDCEHIIVCNLEFEGGRGHDVDGIQIKPNSRHIWIDRCSLRDYDDGLIDITRQ
STDITISRCYFAQHDKTMLIGADPSHVGDRCIRVTIHHCFFDGTRQRQPRVRFGKVHLYNNYTRKLGVYMLFVLARIPDIFSNGTIYEGX
Predicted Coding Sequence 
GATTCTTCCGGTTCAAGTCACCGGCCGGCGGCTAAAGTTTTCCGGTTCATCCACCAAAAACCTAGAGCTCAGAAATTGCTGATCATGGCG
GCGTTGCCATATGCTGATGTCGATTCGAGCTTAAAAGCTCTAGCCGGTCGAGCCGAAGGGTTCGGCAGATTTGCGATCGGCGGTCTAAAT
GGTCCGGTCTATTCCGTCACATCATTGGCCGATGATGGTCCGGGATCACTCCGTGATGGATGCCGTAAGAAAGAACCACTATGGATTGTT
TTTGAAGTTTCAGGCACCATTCATCTCACGTCTTACCTACGTGTGTCATCCCATAAAACTATTGATGGTCGTGGCCAAAGGATAAAACTC
ACTGGCAAAGGCTTACAACTGAAGGATTGTGAGCACATAATCGTATGCAATTTGGAGTTTGAAGGTGGCAGAGGTCATGACGTTGACGGC
ATTCAAATAAAACCAAATTCTAGGCACATTTGGATAGACCGCTGTTCTCTTCGTGATTATGATGATGGGCTAATCGATATTACCAGACAA
AGCACAGATATAACTATTTCTAGATGTTATTTTGCTCAGCATGATAAGACAATGCTTATTGGAGCAGACCCGTCTCATGTTGGTGATAGA
TGTATCAGAGTGACCATCCACCATTGCTTTTTTGATGGGACGAGGCAGAGGCAACCTCGTGTTAGATTTGGTAAAGTTCATCTGTACAAC
AATTACACTAGGAAATTGGGGGTATATATGCTATTTGTGCTAGCTAGAATCCCAGATATATTCTCAAATGGCACCATATATGAAGGTAXX
\
Edits in Original Sequence 
AAATTTAGGATAAAGTTTACTATTGCCTTTTTTTTGTTTTTTTGTTTAAGATCTCCAATATAGAAGCTTTAACTAAACTCCAATATAAAT
ACAGTTGAATT
(5')GATTCTTCCGGTTCAAGTCACCGGCCGGCGGCTAAAGTTTTCCGGTTCATCCACCAAAAACCTAGAGCTCAGtAA
ATTGCTGATCATGGCGGCGTTGCCATATGCTGATGTCGATTCGAGCTTAAAAGCTCTAGCCGGTCGAGCCGAAGGGTTCGGCAGATTTGC
GATCGGCGGTCTAAATGGTCCGGTCTATTCCGTCACATCATTGGCCGATGATGGTCCGGGATCACTCCGTGATGGATGCCGTAAGAAAGA
ACCACTATGGATTGTTTTTGAAGTTTCAGGCACCATTCATCTCACGTCTTACCTACGTGTGTCATCCCATAAAACTATTGATGGTCGTGG
CCAAAGGATAAAACTCACTGGCAAAGGCTTACAACTGAAGGATTGTGAGCACATAATCGTATGCAATTTGGAGTTTGAAGGTGGCAGAGG
TCATGACGTTGACGGCATTCAAATAAAACCAAATTCTAGGCACATTTGGATAGACCGCTGTTCTCTTCGTGATTATGATGATGGGCTAAT
CGATATTACCAGACAAAGCACAGATATAACTATTTCTAGATGTTATTTTGCTCAGCATGATAAGACAATGCTTATTGGAGCAGACCCGTC
TCATGTTGGTGATAGATGTATCAGAGTGACCATCCACCATTGCTTTTTTGATGGGACGAGGCAGAGGCAACCTCGTGTTAGATTTGGTAA
AGTTCATCTGTACAACAATTACACTAGGAAATTGGGGGTATATATGCTATTTGTGCTAGCgTAGAATCCCAGATATATTCTCAAATGGCA
CCATATATGAAGGTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan