ESTScan Details for Unigene SGN-U276928

Score 
342
Direction 
Forward
Predicted Peptide Sequence 
KTLTAKRQRSKFEKSYEFFFVLNSSLSPKEKKLLAENDHTIDSRTGVAAAALAGRYGIQAWQAFKARPPTARMRKFYEGGFQPKMTRREA
ALILGVRESTPADKVREAHRKVMVANHPDAGGSHYLASKINEAKDIMLGKSKNSGSAFXISTESLFGALEVTNYMVTGGGHAFWHYRQL
Predicted Coding Sequence 
XXTAAAACCCTAACAGCAAAAAGGCAAAGATCAAAATTTGAGAAAAGCTATGAGTTCTTCTTTGTTCTGAATTCATCTTTAAGCCCTAAG
GAGAAAAAACTTCTTGCAGAAAATGACCACACCATTGATAGCAGGACTGGTGTTGCTGCTGCTGCATTGGCTGGAAGGTATGGCATCCAG
GCTTGGCAAGCATTCAAGGCCAGACCACCCACTGCAAGAATGCGAAAATTTTATGAAGGAGGTTTTCAGCCTAAAATGACGAGGAGGGAA
GCAGCTCTTATTCTTGGAGTCAGGGAAAGCACTCCAGCAGATAAAGTGAGGGAGGCACATAGGAAGGTGATGGTAGCCAACCATCCAGAT
GCAGGAGGCAGTCACTACCTTGCTTCAAAAATTAATGAAGCGAAAGACATAATGCTTGGGAAGTCTAAGAACAGCGGGTCTGCATTTXTA
ATCTCAACCGAGAGTCTCTTTGGTGCTTTAGAAGTTACAAATTACATGGTAACCGGAGGCGGACATGCTTTCTGGCATTATAGACAACTT
TAA\
Edits in Original Sequence 
(5')XXTAAAACCCTAACAGCAAAAAGGCgAAAGATCAAAATTTGAGAAAAGCTATGAGTTCTTCTTTGTTCTGAATTCATCTTTAAGCC
CTAAGGAGaAAAAAACTTCTTGCAGAAAATGACCACACCATTGATAGCAGGACTGaGTGTTGCTGCTGCTGCATTGGCTGGAAGGTATGG
CATCCAGGCTTGGCAAGCATTCAAGGCCAGACCACCCACTGCAAGAATGCGAAAATTTTATGAAGGAGGTTTTCAGCCTAAAATGACGAG
GAGGGAAGCAGCTCTTATTCTTGGAGTCAGGGAAAGCACTCCAGCAGATAAAGTGAGGGAGGCACATAGGAAGGTGATGGTAGCCAACCA
TCCAGATGCAGGAGGCAGTCACTACCTTGCTTCAAAAATTAATGAAGCGAAAGACATAATGCTTGGGAAGTCTAAGAACAGCGGGTCTGC
ATTTXTAATCTCAACCGAGAGTCTCTTTGGTGCTTTAGAAGTTACAAATTACATGGTAACCGGAGGCGGAtCATGCTTTCTGGCATTATA
GACAACTTTAA\(3')AGTGAAGTAGATTGATTCTTTTTAAAAGATGTATGTTAGTTGGAAAAGGCAACATTTTGATAGTTGTATGAGTT
CACTGAATGTGAAGCCAATATGTACTTTTTAACAATTTGATTACACATTCATGGGTTAATAATTTGGTTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan